Details for Arabidopsis Locus AT3G02410

Position : Chr3 ( 5`- 492118 .. 494948 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02410

Protein [Map View]
MQLSPERCRPMSENREAWSANSEEMELLHGSNRLSSPEHVRRRVSGNSSEDGSPRICRQQSFGRDIGHAAAETYLITRLS
FNLLGYLGVGYRWITRLLALACYAMLLMPGFLQVAYLYFFSSQVRRSIVYGGHPRNRLDLYIPPTSDGLKPVVVFVTGGA
WIIGYKAWGSLLGLQLAERDIIVACLDYRNFPQGTISDMVSDAAQGISFVCNNISAFGGDPNRIYLMGQSAGAHISSCAL
FEQAIKESRGESISWSVSQIKAYFGLSGGYNLFNLVEHFHNRGLYRSIFLSIMEGEESFKQFSPEVRLKDLNVRKAAALL
PHIILFHGSADYSIPPEASKTFTDALQAAEVKAELVMYKGKTHTDLFLQDPLRGGKDELFDHIVSMIHADDSDALRNDAV
APPRKRLVPEFLLKLAGRVSPF*

DNA
ATGCAGTTGTCTCCGGAACGATGCCGTCCGATGTCTGAAAACAGAGAGGCTTGGTCAGCGAATTCCGAGGAAATGGAGCT
GCTTCACGGCTCCAACAGATTATCTTCACCGGAACATGTTCGTAGAAGAGTCTCCGGGAATTCTTCTGAGGACGGTTCGC
CTCGAATTTGCCGGCAGCAGTCGTTCGGTCGCGACATAGGCCATGCAGCTGCCGAGACGTATCTCATTACTCGACTTAGC
TTCAACCTTCTTGGATATCTCGGGGTAGGTTACCGGTGGATCACAAGATTACTTGCTCTTGCTTGTTATGCAATGCTCCT
TATGCCTGGTTTCCTTCAAGTTGCATATCTTTATTTTTTCTCATCTCAAGTCAGGAGGAGTATAGTTTATGGAGGTCATC
CAAGGAATAGGCTGGATTTGTACATACCGCCAACGAGTGATGGCCTGAAGCCGGTTGTAGTTTTCGTTACTGGTGGAGCT
TGGATTATCGGTTACAAAGCTTGGGGTTCTCTCTTGGGACTACAGCTAGCAGAAAGGGACATAATTGTGGCATGTCTAGA
TTACAGAAACTTTCCTCAGGGGACAATTAGTGATATGGTAAGTGATGCAGCTCAAGGAATCTCATTTGTCTGCAATAACA
TCTCTGCATTTGGAGGTGATCCTAACAGAATCTATCTGATGGGGCAATCGGCTGGTGCACATATCTCTTCTTGTGCTCTC
TTTGAACAAGCTATTAAAGAATCAAGAGGGGAGAGCATCTCATGGAGTGTATCTCAGATTAAAGCTTACTTTGGTTTATC
TGGAGGGTACAATCTCTTTAATCTGGTTGAACACTTCCACAACCGAGGCTTGTATCGTTCAATTTTCCTAAGCATAATGG
AAGGAGAAGAGTCCTTTAAACAATTCTCCCCTGAAGTAAGATTGAAAGACCTGAATGTAAGAAAAGCTGCAGCCCTCTTA
CCTCATATTATACTCTTTCATGGATCCGCAGATTATTCAATTCCACCTGAAGCAAGCAAAACTTTTACAGATGCTCTTCA
AGCTGCTGAAGTGAAAGCTGAGCTAGTTATGTACAAGGGTAAAACTCATACCGACCTATTTCTTCAGGATCCTCTGAGAG
GCGGTAAAGATGAGCTATTTGATCATATAGTCTCTATGATACACGCCGATGACAGTGACGCATTGAGAAACGATGCTGTT
GCGCCACCGAGGAAACGGCTTGTTCCAGAGTTCTTGCTGAAACTGGCTGGCAGGGTCAGCCCTTTTTGA