Details for Arabidopsis Locus AT3G02400

Position : Chr3 ( 5`- 489830 .. 491587 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02400

Protein [Map View]
MVPPLLKLDFTQGPRAGDSLGFKPGSTIRIGRIVRGNEIAIKDAGISTKHLRIVSDSENWIIHDLGSSNGTILNSDTIDS
DTPVNLSHGDEIKLGEYTSILVNFGSDVVQAPQEHKLPPRPRRNNKRLAASDPDPDPIESVQEKPKRTRGSSKQEENELP
KSTRASRKKNLDDIADKEEELDVEIEKVVKARVGRPRKNAGSAIAKEEEVVEEKKRVGRPRKNASSAITEEEEVVEEKKG
NSRARRGKNSEIVQKSIKLEVEDTPKAVEISEVKSRKRVTRSKQIENECFGLEVKDEKRTTRSTRSKTTEIGGESFLELE
MVLNQARKSRAKRKKMDEEPSKETRNDDAGEEVLKNCHVEEDKENEAQEGCSGRSDDICDQEDEKECDGSKRVEQVEIEL
RKKSTVEGLKCTDKEDGETENSQDIERERENENEKEAQEGCSERSDKEYERVGGGAKRVEQVEIELRKKSTVGEDDLNCT
VREDGETENLQEIEEECHDEESDCKVEEAGFATLDEEKVGQGWNNKKVERVEVYLEKMKLREWFDAIEVQLPKQTIEETE
KMIEPMRSKSMRVHKHIAEQKEKGD*

DNA
ATGGTTCCGCCATTGCTGAAGCTCGACTTCACCCAGGGTCCAAGAGCTGGCGATTCTCTAGGGTTTAAACCCGGATCCAC
TATCCGAATTGGTCGAATCGTCCGTGGTAATGAAATCGCCATCAAAGACGCCGGAATCTCCACCAAGCACCTCCGGATCG
TTTCCGATTCCGAGAACTGGATAATCCACGATCTTGGTTCTTCCAACGGCACCATATTGAACTCTGACACTATCGACTCA
GATACGCCCGTCAATCTTAGCCATGGAGACGAAATTAAGCTTGGTGAGTACACTTCCATTTTGGTGAACTTTGGGAGTGA
TGTTGTTCAGGCGCCGCAGGAGCATAAGCTTCCGCCCAGGCCAAGGAGGAACAACAAGCGGCTTGCTGCTTCGGATCCGG
ATCCGGATCCTATTGAGTCGGTTCAGGAGAAACCAAAGCGCACGCGTGGATCGTCGAAGCAAGAGGAAAATGAACTGCCC
AAGAGTACTAGGGCTTCGAGGAAAAAGAATCTGGACGATATCGCCGATAAAGAAGAGGAATTGGATGTGGAAATTGAGAA
GGTGGTCAAAGCTAGGGTTGGGAGGCCTCGGAAGAACGCAGGCAGTGCAATTGCGAAGGAAGAAGAAGTTGTGGAGGAGA
AAAAAAGGGTTGGGAGGCCCCGGAAGAACGCAAGTAGTGCAATTACGGAGGAAGAAGAAGTTGTGGAGGAGAAAAAAGGC
AACTCTAGGGCTCGGAGAGGTAAGAACAGTGAGATTGTCCAGAAATCAATCAAATTGGAAGTTGAGGATACTCCCAAGGC
AGTGGAAATCTCAGAGGTGAAAAGCAGGAAGAGAGTGACAAGGAGCAAGCAGATAGAAAATGAATGTTTTGGATTGGAGG
TTAAAGATGAGAAGAGAACTACAAGGTCTACCAGAAGCAAGACGACTGAAATTGGTGGAGAGTCTTTTCTGGAGTTGGAG
ATGGTCCTGAACCAAGCCCGGAAAAGCCGTGCAAAGAGGAAGAAAATGGATGAGGAGCCATCCAAGGAGACTAGAAATGA
TGATGCCGGAGAAGAGGTTTTGAAGAACTGTCATGTTGAAGAAGATAAGGAAAATGAAGCTCAGGAAGGTTGCAGTGGAA
GAAGTGATGACATATGTGATCAAGAAGATGAGAAGGAATGCGATGGATCTAAGAGGGTAGAGCAGGTGGAGATTGAGTTA
AGGAAGAAAAGCACAGTAGAAGGCCTGAAATGCACTGATAAAGAAGATGGAGAAACAGAGAACTCACAAGATATTGAAAG
AGAAAGAGAAAATGAAAATGAAAAAGAAGCTCAAGAAGGTTGCAGTGAAAGAAGTGATAAAGAATATGAGAGGGTTGGTG
GTGGGGCTAAGAGGGTAGAGCAGGTGGAGATTGAGTTAAGGAAGAAAAGCACCGTAGGAGAAGATGACCTGAACTGTACT
GTTAGAGAAGATGGAGAGACAGAAAACTTACAAGAAATTGAAGAAGAGTGTCACGACGAGGAAAGTGACTGCAAGGTCGA
GGAGGCTGGATTTGCGACATTAGATGAGGAAAAGGTTGGGCAGGGATGGAACAATAAGAAAGTAGAGAGGGTAGAAGTAT
ATTTAGAAAAAATGAAACTAAGAGAATGGTTTGATGCCATAGAGGTTCAACTGCCAAAACAGACAATTGAAGAAACAGAG
AAGATGATTGAGCCCATGAGAAGTAAGAGTATGAGAGTTCACAAGCATATTGCAGAGCAAAAGGAAAAGGGCGACTAA