Details for Arabidopsis Locus AT3G02380

Position : Chr3 ( 5`- 487236 .. 488693 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02380

Protein [Map View]
MLKEESNESGTWARACDTCRSAACTVYCEADSAYLCTTCDARVHAANRVASRHERVRVCQSCESAPAAFLCKADAASLCT
ACDAEIHSANPLARRHQRVPILPLSANSCSSMAPSETDADNDEDDREVASWLLPNPGKNIGNQNNGFLFGVEYLDLVDYS
SSMDNQFEDNQYTHYQRSFGGDGVVPLQVEESTSHLQQSQQNFQLGINYGFSSGAHYNNNSLKDLNHSASVSSMDISVVP
ESTASDITVQHPRTTKETIDQLSGPPTQVVQQLTPMEREARVLRYREKKKTRKFDKTIRYASRKAYAEIRPRIKGRFAKR
IETEAEAEEIFSTSLMSETGYGIVPSF*

DNA
ATGTTGAAAGAAGAGAGTAATGAGAGTGGTACTTGGGCACGAGCATGTGACACTTGTCGTTCAGCCGCCTGCACTGTCTA
CTGTGAAGCCGACTCTGCCTACTTGTGCACCACCTGTGATGCTCGAGTTCACGCAGCCAACCGTGTTGCTTCTCGCCATG
AACGTGTTCGTGTCTGTCAGTCATGTGAGTCTGCCCCAGCTGCGTTTTTGTGTAAAGCAGACGCTGCGTCTCTTTGTACA
GCTTGTGATGCAGAGATTCATTCCGCAAACCCACTAGCTAGACGTCATCAGCGAGTTCCGATTCTTCCATTATCTGCAAA
CTCTTGCAGCTCCATGGCCCCAAGTGAGACTGATGCTGATAACGATGAGGATGATCGAGAGGTTGCTTCGTGGTTACTCC
CTAATCCAGGGAAAAACATCGGTAATCAGAATAATGGGTTCTTGTTTGGTGTTGAGTACCTTGATCTTGTGGATTACAGC
TCCAGCATGGACAACCAATTCGAAGATAATCAGTACACTCACTACCAGAGGAGCTTTGGAGGAGATGGAGTTGTGCCGCT
TCAAGTTGAAGAATCAACAAGTCACCTGCAACAAAGCCAACAAAACTTTCAGTTGGGTATCAACTATGGATTCTCCTCAG
GAGCTCACTACAACAACAACTCCTTAAAGGACCTAAACCATAGCGCATCCGTTTCATCAATGGACATCAGTGTTGTGCCA
GAGTCAACTGCAAGTGACATAACAGTCCAACACCCAAGAACTACTAAAGAGACGATAGACCAACTATCTGGTCCTCCTAC
TCAGGTGGTGCAACAGCTTACTCCAATGGAGAGGGAGGCTAGGGTCCTGAGATACAGAGAGAAGAAGAAGACAAGGAAAT
TTGACAAGACAATAAGATATGCTTCAAGAAAGGCATATGCAGAGATAAGACCACGGATCAAGGGCAGATTCGCAAAGAGG
ATAGAAACTGAAGCTGAGGCTGAAGAAATCTTCTCAACATCGCTAATGTCTGAGACTGGATATGGAATTGTCCCTTCCTT
CTAA