Details for Arabidopsis Locus AT3G02370

Position : Chr3 ( 5`- 484491 .. 485614 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02370

Protein [Map View]
MAEVEVKRGKLWTTTGIIRTGKTYCFIEEALYLSEIGELQLLGDEDDVVISLKDLYGEIAEGKYGCCWENYEVYRYLKGL
GYILGRHGVPWTTKYAVNTTPSDEDESLCAAEFFQDRDSVTKLLSDMHICDARPVFDVYLPNSQFKKSSPGEPSFVTCFS
GDSPPSKEEIKTSLSYHKCEKRKRNALVPSDKGDKTE*

DNA
ATGGCCGAAGTTGAGGTCAAAAGGGGTAAACTTTGGACGACAACTGGAATTATCCGTACCGGAAAAACATATTGCTTCAT
AGAAGAGGCTCTGTATTTGAGTGAAATTGGAGAGTTGCAGCTCTTGGGTGATGAGGATGACGTAGTGATTTCATTGAAGG
ACTTGTATGGGGAAATAGCGGAGGGAAAATATGGCTGCTGTTGGGAAAACTACGAGGTTTATAGATACTTAAAGGGTCTT
GGTTACATTCTAGGCAGACATGGAGTTCCTTGGACTACAAAATATGCTGTGAATACTACACCAAGTGATGAAGATGAGTC
ACTTTGTGCTGCAGAATTTTTCCAAGACAGAGACTCTGTTACCAAACTCCTGAGTGATATGCATATCTGTGATGCAAGAC
CGGTGTTTGATGTGTATTTGCCAAACAGCCAGTTCAAGAAGTCTTCTCCTGGTGAACCGAGCTTTGTCACTTGCTTCTCG
GGAGACTCTCCACCAAGTAAAGAAGAAATTAAAACCTCCTTGTCTTACCATAAATGTGAGAAAAGAAAACGGAATGCTCT
TGTGCCATCAGACAAAGGTGACAAAACTGAGTGA