Details for Arabidopsis Locus AT3G02360

Position : Chr3 ( 5`- 481898 .. 484147 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02360

Protein [Map View]
MAVQPTRIGLAGLAVMGQNLALNIAEKGFPISVYNRTTSKVDETVERAKKEGNLPLYGFHDPESFVKSIQKPRVIIMLVK
AGSPVDQTIKTLSAYLEKGDCIVDGGNEWYENTERREKAVAENGFLYLGMGVSGGEEGARNGPSMMPGGSYEAYKNIEDI
VLKVAAQVRDSGPCVTYIGKGGSGNFVKMVHNGIEYGDMQLIAEAYDVLKSVGKLSNEELHSVFSDWNKGELESFLVEIT
ADIFGIKDDKGDGHLVDKVLDKTGMKGTGKWTVQQAAELSVPAPTIESSLDARFLSGLKDERVQAAKVFKAGGFGDILTD
QKVDKKQLVDDVRKALYASKICSYAQGMNLIRAKSIEKGWGLKLGELARIWKGGCIIRAIFLDRIKQAYDRNAELANLLV
DPEFAKEIIERQSAWRRVVCLAINSGISTPGMSASLAYFDSYRRERLPANLVQAQRDYFGAHTYERTDVEGSFHTEWFKI
ARQSKI*

DNA
ATGGCTGTTCAACCTACAAGAATAGGTCTAGCTGGACTTGCTGTGATGGGTCAGAACCTAGCTCTCAACATTGCAGAGAA
AGGCTTCCCAATCTCTGTTTACAACAGAACTACTTCCAAAGTTGATGAGACCGTCGAACGAGCCAAAAAGGAAGGCAATC
TTCCTCTTTACGGCTTCCATGACCCCGAGTCTTTTGTCAAGTCCATTCAGAAGCCACGCGTTATTATCATGCTTGTTAAG
GCTGGTTCTCCCGTTGACCAGACCATCAAGACCCTCTCTGCTTATTTGGAGAAAGGTGACTGTATTGTCGATGGTGGTAA
TGAATGGTATGAGAACACTGAGAGGAGAGAAAAAGCCGTGGCGGAGAACGGTTTCCTCTACCTTGGAATGGGAGTTTCTG
GTGGTGAAGAAGGTGCTCGTAATGGCCCATCTATGATGCCTGGAGGCTCTTATGAAGCCTACAAGAATATCGAAGACATT
GTTCTCAAGGTTGCTGCTCAGGTTAGGGATAGTGGTCCCTGTGTGACTTATATCGGTAAGGGCGGGTCTGGAAACTTTGT
CAAAATGGTCCACAATGGGATCGAGTACGGTGATATGCAGCTGATTGCAGAAGCTTATGACGTCCTCAAGTCTGTTGGTA
AATTATCGAATGAGGAGCTTCACAGTGTCTTCTCTGACTGGAACAAAGGTGAGCTTGAGAGTTTCTTGGTAGAGATCACA
GCAGATATTTTCGGGATCAAGGACGATAAGGGAGATGGGCATTTGGTTGACAAGGTCTTGGACAAAACCGGCATGAAAGG
CACAGGAAAGTGGACCGTGCAGCAAGCTGCTGAGCTATCTGTTCCTGCTCCCACCATTGAATCCTCTCTTGATGCGAGGT
TCCTTAGCGGGCTTAAAGATGAACGTGTGCAAGCAGCTAAAGTCTTCAAGGCAGGTGGGTTTGGAGATATCTTGACCGAT
CAGAAAGTTGACAAGAAACAGCTAGTCGATGACGTGAGGAAGGCTCTTTACGCATCCAAAATCTGCAGCTACGCACAAGG
CATGAACCTTATCCGTGCCAAGAGCATAGAAAAGGGGTGGGGATTGAAGCTAGGTGAGTTAGCTAGAATCTGGAAAGGAG
GCTGCATCATCAGAGCAATCTTCCTAGACAGGATCAAGCAAGCTTATGACAGGAACGCAGAGCTAGCTAACCTCTTGGTG
GATCCAGAGTTTGCGAAAGAGATAATCGAGAGACAGTCCGCGTGGAGAAGAGTCGTCTGCTTAGCTATCAACTCGGGTAT
CAGCACACCGGGTATGTCTGCGAGTCTAGCCTACTTTGATTCTTACAGGAGAGAGAGATTGCCGGCAAATCTAGTCCAAG
CACAGAGAGACTACTTTGGTGCTCATACATATGAAAGGACTGATGTGGAAGGATCTTTCCACACCGAGTGGTTCAAGATT
GCAAGACAATCTAAGATCTGA