Details for Arabidopsis Locus AT3G02340

Position : Chr3 ( 5`- 477003 .. 478442 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02340

Protein [Map View]
MASTKPDSAINLEEEAEGDGVAVDDPIFIPETTNLLVRYSPFDDRDIDCNPYFPFTGPISDSGSGSYSDSEPDPNSCPID
FFDRDSSDVDVAEYLESGGLTAGDYNIWGFYDPKEDEEEEEIVLGTSGSDLQPGDSGEQGLRVTGIDSDSDCEDGVFDFI
SEDSSGNRGNDSGRVEVGTGLPPVWDHLFGEGTVLADEEWEEVQNAINWTAFSGPEDEDEEDELSSLSRDDEEEDHELDW
QVLLTVNNVVNYIEQAEGIMLNPDDIDPDYYLYLSGLDEFDENHSGHYDADAILGQMFDDETGIRGNPPAAKSVIQDLPV
VELAVEELDKGNNVCAVCKDEMLVEEKVRRLPCSHFYHGECIIPWLGIRNTCPVCRYELPTDDLEYERHKSSERGDTGLA
RNVLPGRYS*

DNA
ATGGCGTCGACGAAGCCCGATTCCGCAATCAACCTTGAAGAAGAGGCTGAAGGCGACGGTGTAGCCGTAGACGATCCGAT
TTTCATACCGGAGACCACGAACTTACTCGTCCGTTACTCGCCATTCGACGACAGGGACATCGATTGCAATCCTTATTTCC
CTTTCACAGGCCCGATTTCAGATTCTGGATCAGGTTCTTACTCGGATTCTGAGCCCGATCCCAACAGCTGTCCCATCGAT
TTCTTCGATCGAGATTCTTCCGATGTTGACGTGGCTGAGTACTTGGAATCAGGAGGGCTGACCGCCGGTGATTATAATAT
TTGGGGCTTTTATGACCCCAAGGAAGACGAGGAAGAGGAGGAGATAGTTTTGGGGACTTCCGGGTCGGATCTGCAACCGG
GTGATTCAGGGGAGCAAGGGCTTCGAGTGACCGGTATCGATTCAGATTCCGATTGTGAAGATGGCGTGTTTGATTTTATC
TCTGAGGATAGTAGCGGGAATAGGGGAAATGATTCGGGTCGGGTCGAGGTTGGTACGGGTCTTCCTCCTGTGTGGGATCA
TCTCTTCGGAGAGGGAACCGTGTTGGCTGATGAAGAATGGGAGGAGGTGCAGAACGCGATTAACTGGACAGCTTTTAGTG
GACCCGAAGATGAGGACGAAGAAGATGAATTGTCTTCACTATCAAGGGATGATGAAGAAGAAGATCATGAACTGGACTGG
CAGGTTTTGTTAACTGTTAACAATGTTGTTAATTATATCGAACAAGCTGAAGGAATCATGCTAAACCCTGATGATATCGA
TCCGGATTATTACCTGTATCTATCTGGTTTGGATGAATTTGATGAAAATCATAGTGGACATTATGATGCTGATGCTATTC
TTGGGCAAATGTTTGATGACGAGACTGGAATCAGGGGAAATCCTCCAGCAGCCAAAAGTGTAATTCAGGATCTTCCGGTT
GTGGAGCTTGCTGTGGAAGAGTTAGACAAAGGGAACAATGTTTGTGCGGTATGCAAAGATGAAATGTTAGTGGAGGAGAA
AGTAAGGAGGCTTCCTTGTAGTCATTTCTATCATGGAGAGTGTATCATACCTTGGTTGGGGATAAGGAATACTTGCCCGG
TTTGTCGGTATGAGCTGCCTACTGATGATCTTGAGTATGAAAGACATAAGAGCTCAGAAAGGGGCGATACTGGTTTGGCA
AGGAACGTGTTGCCGGGTAGATATAGTTAA