Details for Arabidopsis Locus AT3G02330

Position : Chr3 ( 5`- 473881 .. 476592 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02330

Protein [Map View]
MAESLRLLHMTRSVVSFNRCLTEKISYRRVPSFSYFTDFLNQVNSVSTTNFSFVFKECAKQGALELGKQAHAHMIISGFR
PTTFVLNCLLQVYTNSRDFVSASMVFDKMPLRDVVSWNKMINGYSKSNDMFKANSFFNMMPVRDVVSWNSMLSGYLQNGE
SLKSIEVFVDMGREGIEFDGRTFAIILKVCSFLEDTSLGMQIHGIVVRVGCDTDVVAASALLDMYAKGKRFVESLRVFQG
IPEKNSVSWSAIIAGCVQNNLLSLALKFFKEMQKVNAGVSQSIYASVLRSCAALSELRLGGQLHAHALKSDFAADGIVRT
ATLDMYAKCDNMQDAQILFDNSENLNRQSYNAMITGYSQEEHGFKALLLFHRLMSSGLGFDEISLSGVFRACALVKGLSE
GLQIYGLAIKSSLSLDVCVANAAIDMYGKCQALAEAFRVFDEMRRRDAVSWNAIIAAHEQNGKGYETLFLFVSMLRSRIE
PDEFTFGSILKACTGGSLGYGMEIHSSIVKSGMASNSSVGCSLIDMYSKCGMIEEAEKIHSRFFQRANVSGTMEELEKMH
NKRLQEMCVSWNSIISGYVMKEQSEDAQMLFTRMMEMGITPDKFTYATVLDTCANLASAGLGKQIHAQVIKKELQSDVYI
CSTLVDMYSKCGDLHDSRLMFEKSLRRDFVTWNAMICGYAHHGKGEEAIQLFERMILENIKPNHVTFISILRACAHMGLI
DKGLEYFYMMKRDYGLDPQLPHYSNMVDILGKSGKVKRALELIREMPFEADDVIWRTLLGVCTIHRNNVEVAEEATAALL
RLDPQDSSAYTLLSNVYADAGMWEKVSDLRRNMRGFKLKKEPGCSWVELKDELHVFLVGDKAHPRWEEIYEELGLIYSEM
KPFDDSSFVRGVEVEEEDQWCYC*

DNA
ATGGCGGAGAGTCTCAGATTATTGCATATGACCAGATCAGTGGTTTCATTCAATCGTTGTCTAACAGAGAAAATTTCATA
CCGGAGAGTTCCAAGCTTTTCTTATTTCACTGATTTTCTGAATCAAGTGAACTCAGTTAGCACGACGAACTTTTCGTTTG
TTTTCAAGGAATGTGCGAAGCAAGGAGCGTTAGAGCTAGGCAAGCAAGCTCATGCTCATATGATAATATCTGGGTTTCGT
CCGACTACATTCGTACTGAACTGTTTGCTGCAGGTCTACACAAATTCAAGAGATTTCGTGTCTGCTTCTATGGTGTTCGA
CAAAATGCCGCTGAGAGATGTTGTTTCTTGGAACAAAATGATAAATGGTTACTCGAAGAGTAATGACATGTTTAAAGCGA
ATTCTTTCTTCAATATGATGCCTGTGAGAGATGTTGTGTCTTGGAACTCAATGCTTTCTGGGTATCTGCAAAACGGCGAG
AGTTTGAAATCTATCGAGGTTTTCGTTGACATGGGGAGAGAAGGTATTGAGTTTGACGGTAGAACTTTTGCAATTATTCT
TAAAGTTTGTTCCTTTTTAGAGGATACCAGTTTAGGAATGCAGATTCATGGGATTGTCGTTCGAGTGGGTTGTGATACTG
ATGTGGTTGCTGCGAGTGCGTTGTTGGATATGTATGCAAAAGGCAAGAGGTTTGTCGAGTCTCTTAGAGTGTTTCAAGGT
ATACCAGAGAAGAATTCTGTCTCGTGGAGTGCTATAATCGCAGGTTGTGTTCAGAATAACTTGTTGTCCCTTGCTTTGAA
GTTTTTCAAGGAGATGCAAAAGGTAAATGCTGGAGTGAGCCAGTCAATTTACGCTAGCGTCTTGAGGTCATGTGCTGCGT
TATCCGAATTGAGGTTAGGCGGTCAGTTACATGCTCATGCCTTGAAGTCAGATTTTGCAGCAGATGGTATAGTGAGGACG
GCGACATTGGACATGTACGCAAAGTGTGATAATATGCAAGATGCTCAAATTTTGTTTGACAACTCAGAAAATCTTAATAG
GCAATCTTATAACGCAATGATTACTGGTTATTCGCAAGAAGAACATGGTTTCAAAGCTCTACTGTTGTTTCACCGACTCA
TGTCATCGGGTCTTGGTTTCGACGAGATAAGTTTATCAGGAGTATTCAGGGCTTGTGCCTTGGTGAAAGGACTTTCAGAG
GGGCTTCAGATTTACGGTTTGGCGATAAAAAGCAGCTTATCGCTAGATGTTTGCGTTGCAAATGCTGCTATCGACATGTA
TGGGAAATGTCAAGCTCTGGCTGAAGCCTTTCGTGTATTCGATGAGATGAGAAGACGAGACGCTGTGTCTTGGAATGCGA
TTATAGCTGCACATGAGCAGAACGGAAAAGGATATGAAACGCTTTTTCTTTTTGTCTCGATGCTCCGTTCTAGGATCGAA
CCTGATGAGTTTACCTTTGGAAGCATATTGAAAGCTTGCACTGGTGGTTCTTTAGGTTACGGTATGGAGATCCATTCCAG
CATTGTCAAATCAGGAATGGCTTCAAACTCCTCTGTCGGATGCTCTCTGATCGATATGTATTCAAAGTGTGGAATGATAG
AAGAGGCGGAGAAGATACATAGTCGATTCTTTCAACGAGCCAATGTCTCGGGAACAATGGAAGAGCTTGAAAAGATGCAC
AATAAGAGACTGCAGGAAATGTGTGTTTCATGGAATTCAATTATTTCCGGATATGTAATGAAGGAACAAAGCGAGGATGC
TCAGATGCTTTTTACCCGGATGATGGAGATGGGTATAACTCCTGACAAATTTACTTATGCAACAGTTCTTGATACCTGTG
CGAATCTTGCTTCCGCTGGATTAGGTAAACAGATTCATGCTCAGGTCATCAAGAAAGAATTGCAATCTGATGTGTATATC
TGTAGCACCCTCGTTGACATGTACTCGAAATGTGGAGATCTCCATGATTCAAGATTGATGTTTGAGAAGTCGCTGAGAAG
AGATTTCGTGACCTGGAACGCCATGATTTGCGGGTATGCACATCATGGGAAAGGAGAGGAAGCTATACAACTGTTTGAGA
GAATGATACTCGAAAACATCAAACCAAATCACGTTACTTTCATATCGATACTCCGAGCTTGTGCTCACATGGGTCTGATC
GACAAAGGGCTCGAGTACTTCTATATGATGAAGAGAGACTATGGCCTGGATCCTCAGCTACCGCATTACTCGAACATGGT
AGATATATTAGGAAAATCCGGAAAAGTCAAGAGAGCATTAGAGCTTATTCGAGAGATGCCATTTGAAGCAGACGATGTCA
TATGGAGAACCCTGTTAGGAGTCTGCACGATACATAGAAACAATGTAGAGGTTGCAGAAGAAGCAACTGCTGCCCTGTTG
AGATTGGATCCACAAGACTCTTCAGCTTATACACTTTTATCAAATGTATACGCAGATGCAGGAATGTGGGAAAAGGTTTC
AGATTTGAGGAGAAATATGAGAGGCTTTAAGCTTAAGAAGGAGCCTGGTTGCAGTTGGGTTGAGCTAAAAGATGAGCTTC
ATGTGTTTCTCGTTGGAGATAAGGCTCATCCTAGATGGGAAGAGATTTACGAAGAGCTTGGTTTGATTTACAGTGAAATG
AAACCTTTTGATGATTCTTCTTTCGTGCGTGGGGTTGAAGTAGAAGAAGAGGACCAATGGTGTTACTGCTAA