Details for Arabidopsis Locus AT3G02310

Position : Chr3 ( 5`- 464279 .. 467074 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02310

Protein [Map View]
MGRGRVELKRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVSLIVFSNRGKLYEFCSTSNMLKTLERYQKCSYGSIEV
NNKPAKELENSYREYLKLKGRYENLQRQQRNLLGEDLGPLNSKELEQLERQLDGSLKQVRCIKTQYMLDQLSDLQGKEHI
LLDANRALSMKLEDMIGVRHHHIGGGWEGGDQQNIAYGHPQAHSQGLYQSLECDPTLQIGYSHPVCSEQMAVTVQGQSQQ
GNGYIPGWML*

DNA
ATGGGAAGAGGAAGAGTAGAGCTCAAGAGGATAGAGAACAAAATCAACAGACAAGTGACGTTTGCTAAACGTAGAAATGG
TTTGCTGAAAAAAGCTTATGAGCTTTCTGTTCTCTGCGATGCTGAAGTCTCTCTCATCGTCTTCTCCAACCGTGGCAAGC
TCTACGAGTTCTGCAGCACCTCCAACATGCTCAAGACACTGGAAAGGTATCAGAAGTGTAGCTATGGCTCCATTGAAGTC
AACAACAAACCTGCTAAAGAGCTTGAGAACAGCTACAGAGAGTACTTGAAGCTGAAAGGTAGATATGAAAATCTGCAACG
TCAGCAGAGAAATCTTCTTGGAGAGGATCTTGGACCTCTGAATTCAAAGGAGCTAGAGCAGCTTGAGCGTCAACTAGACG
GCTCTCTGAAGCAAGTTCGCTGCATCAAGACACAGTATATGCTTGACCAGCTCTCTGATCTTCAAGGTAAGGAGCATATC
TTGCTTGATGCCAACAGAGCTTTGTCAATGAAGCTGGAAGATATGATCGGCGTGAGACATCACCATATAGGAGGAGGATG
GGAAGGTGGTGATCAACAGAATATTGCCTATGGACATCCTCAGGCTCATTCTCAGGGACTATACCAATCTCTTGAATGTG
ATCCCACTTTGCAAATTGGATATAGCCATCCAGTGTGCTCAGAGCAAATGGCTGTGACGGTGCAAGGTCAGTCCCAACAA
GGAAACGGCTACATCCCTGGCTGGATGCTGTGA