Details for Arabidopsis Locus AT3G02300

Position : Chr3 ( 5`- 461148 .. 464174 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02300

Protein [Map View]
MDIGEIIGEVAPSVSIPTKSAIYVWGYNQSGQTGRNEQEKLLRIPKQLPPELFGCPAGANSRWLDISCGREHTAAVASDG
SLFAWGANEYGQLGDGTEVGRKHPKKVKQLQSEFVKFVSCGAFCTAAIAEPRENDGTLSTSRLWVWGQNQGSNLPRLFSG
AFPATTAIRQVSCGTAHVVALSEEGLLQAWGYNEQGQLGRGVTCEGLQAPRVINAYAKFLDEAPELVKIMQLSCGEYHTA
ALSDAGEVYTWGLGSMGQLGHVSLQSGDKELIPRRVVGLDGVSMKEVACGGVHTCALSLEGALYAWGGGQAGQLGLGPQS
GFFFSVSNGSEMLLRNVPVLVIPTDVRLVACGHSHTLVYMREGRICGWGYNSYGQAANEKSSYAWYPSPVDWCVGQVRKL
AAGGGHSAVLTDAFSLKELCEFQLADSVNLSNASEIQDVAFRMGSEALARLCERLREQLLDGDFTNGEEVY*

DNA
ATGGATATTGGAGAAATCATTGGTGAAGTAGCTCCTTCTGTGAGTATCCCAACGAAGAGTGCTATATACGTTTGGGGTTA
CAATCAAAGCGGACAAACTGGTAGGAATGAACAAGAGAAGCTTTTGCGTATCCCAAAACAGCTTCCTCCTGAGCTTTTTG
GTTGCCCCGCTGGTGCCAATTCGCGTTGGCTCGATATTTCTTGTGGTCGGGAACATACAGCTGCGGTTGCATCAGATGGT
TCTCTCTTTGCTTGGGGTGCTAATGAATATGGTCAGCTTGGGGATGGAACCGAGGTTGGGAGGAAACATCCAAAGAAGGT
GAAACAGCTGCAATCAGAATTTGTGAAATTTGTGTCTTGTGGAGCTTTTTGCACTGCAGCTATCGCAGAACCCCGTGAAA
ATGACGGTACTCTTTCCACTAGTAGACTCTGGGTTTGGGGCCAAAATCAGGGATCAAATCTACCACGCTTGTTTTCGGGG
GCATTTCCTGCTACAACGGCAATCCGCCAAGTATCATGTGGGACAGCTCATGTTGTGGCCTTATCAGAGGAAGGCCTTCT
TCAAGCTTGGGGCTATAATGAACAAGGCCAACTTGGTAGAGGAGTCACTTGTGAAGGACTACAAGCACCTCGTGTGATAA
ATGCTTATGCGAAGTTCCTTGATGAAGCACCCGAGCTTGTGAAGATTATGCAACTTTCATGTGGAGAATACCATACTGCT
GCTCTTTCTGATGCAGGCGAGGTTTACACTTGGGGATTAGGAAGCATGGGTCAACTTGGGCATGTTTCTCTTCAATCCGG
GGATAAGGAGTTAATACCAAGGAGAGTCGTTGGTCTCGATGGTGTGTCCATGAAAGAAGTTGCTTGTGGTGGTGTACACA
CTTGTGCTTTATCTTTGGAAGGAGCACTTTATGCTTGGGGTGGTGGCCAAGCAGGACAGCTAGGACTTGGTCCTCAATCT
GGTTTCTTTTTTAGTGTCTCTAATGGAAGCGAAATGCTTCTACGAAATGTCCCGGTTTTAGTCATCCCAACTGATGTCAG
GCTTGTTGCGTGTGGACATTCTCACACTCTCGTTTATATGAGAGAGGGACGAATTTGTGGATGGGGTTATAATAGTTATG
GTCAAGCAGCAAATGAGAAATCGTCATATGCTTGGTACCCATCGCCTGTAGACTGGTGTGTAGGACAAGTGAGGAAGCTA
GCAGCAGGAGGTGGTCATTCAGCTGTTTTAACCGATGCATTTTCGTTGAAGGAGTTGTGTGAATTTCAATTAGCAGATAG
TGTGAACCTCTCAAATGCTTCAGAGATTCAAGATGTTGCATTCAGAATGGGATCCGAAGCTTTAGCCCGCCTCTGCGAAA
GACTGAGGGAGCAGTTACTTGATGGGGACTTTACTAATGGGGAAGAAGTATATTAA