Details for Arabidopsis Locus AT3G02260

Position : Chr3 ( 5`- 430984 .. 448489 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02260

Protein [Map View]
MADDLANLCRFLFDDTAFPSLSSSASSDLFSRRLRSDDSIKRGLRSFYLLLRWGVAPIGGDDADSSGKLRFETWSDSQLQ
ALVSISQAILLLSRSLLGTDLTLNQGLVDQLEPIVLGVIQEVMEFSLSFLEKSSFRQNDLKMEINMEILLEIASFDGSEK
QYDILPDFSPAEVAELWPAFSGEHDNMDAQSLVKCTFQGGRCSNEEKPVDRLLITLMSECIESDVQAQSVVKSPFQQDCG
DLNPFTRHLAVVHLRCVCRLIMVCKELVQLPNMLDEKTVDQAVLDKLSFCLRILKLLGSLSKDVQSIENDGSLLQAVASF
TDAFPKLFRVFFEFTNHTATEGNIESLSLALVEGFLNLVQLIFGKSSVFQNVQACVAASIVSNLDSSVWRYDGSSCNLTP
PLAYFPRSVIYTLKLIQDLKRQPYHIHDLRVLESEVTYEDVSSTVDSVYFHLRQEKIPLLKCFTVEDIMRVIFPSSSQWM
DNFFHLVYFLHREGVKLRPKVERTYSSLRSNSFAEVESQISHDDEALFGNLFSEGSRSLCSIEPNDQPPVSVSSNLLLQA
AKELLNFLRACILCQEWVPSIYEDGCKKLDTGHIDILLNIVGCSIEDKASDGGCMLQDEGRPGHVAFELLLNLLRSRALS
DFLESYLFQQILVVENSDFNYNDKTLALLAHTLLCRPGLAGAQLRAKIYDGFVSFVTERARGICAEALSLKELTACLPSA
FHIEILLMAFHLSNEAEKAKFSNLIASCLHKVDTPAGICDGPQLSSWAMLISRLLVLLHHMLLHPNTCPTSLMLDLRSKL
REVRSCGSNLHVTVGDHLSSWASLVARGITDSWAEDESVSHLMSQMIDFSPHPPTFQNDVSTAKTLNLDYGDLSASLCRV
LGLWKGKKAGKVEDLLVERYIFMLSSDIARINCALDSQPSLHVNYQNVDISNSVDLISTSHLLVGDINVVGRNIELRNIL
IGVLNQLQAAPEQVVEDLGWDYIREGAWLSLLLYFLDGGVWDYCNKNSCSEIDPFWKECTSVDAKYVAAAEGVVSYLMKT
GDIAELLRMLSSLVGKYLRVYKKAFLATFSDWNHHGHSSPSLLLLKHTQFGKSLQGEYAKIGDNSLHLQCIFYLSKLDSL
GDGRGSGVLWKVFWEFMVHGFPTSLQTSSAILLSCILSIRCIVLTINGLLKLGNSKEKFGVDTSVLHQLLDSIMIIKFDQ
VFESFHGKCEEIHQNICAVLQLPDLTELFLMKDMEGFVRDISAEQIDRSQVLEGVITKIVDVMDSLSKDSSKSDIFKFYL
GVDAVSEHTREFYELQRGDLSVFIDSLDYCSLEPVNIKVLNFLVDLLSVAQSPDLRRRVQQKFIDMDLISLSGWLERRLL
GSFVEEIDGKKTAKGNSLPFREAAMNFINCLVSSTNDLQTRELQNHLFEALLISLDTAFLSFDIHMSMSYFHFVLQLARE
DNLMKMVLKRTIMLMEKLAAEEKLLPGLKFIFGVIGTLLSNRSPSHGESLCGKSLASYKNTATGPLVPKLSGTTKKSDTL
ALPVDQEGSSISLECDVTSVDEDEDDGTSDGEVASLDKEDEEDANSERYLASKVCTFTSSGSNFMEQHWYFCYTCDLTVS
KGCCSVCAKVCHRGHRVVYSRSSRFFCDCGAGGVRGSSCQCLKPRKYNGNGSAPARGTNNFQSFLPLSEDADQLGESDSD
VEEDGFGEENHVVLYIPKETQYKMSLLLEELGIEDRVLELFSSLLPSITSKRDSGLSKEKQVNLGKDKVLSFDTDLLQLK
KAYKSGSLDLKIKADYTNSKDLKSLLANGSLVKSLLSVSVRGRLAVGEGDKVAIFDVGQLIGQATIAPINADKANVKPLS
RNIVRFEIVHLSFNPVVENYLAVAGLEDCQILTLNHRGEVIDRLAVELALQGAFIRRIDWVPGSQVQLMVVTNKFVKIYD
LSQDSISPTQYFTLPNDMIVDATLFVASRGRVFLLVLSEQGNLYRFELSWGGNAGATPLKEIVQIMGKDVTGKGSSVYFS
PTYRLLFISYHDGSSFMGRLSSDATSLTDTSGMFEEESDCKQRVAGLHRWKELLAGSGLFICFSSVKSNAVLAVSLRGDG
VCAQNLRHPTGSSSPMVGITAYKPLSKDNVHCLVLHDDGSLQIYSHVRSGVDTDSNFTAEKVKKLGSKILNNKTYAGAKP
EFPLDFFERAFCITADVRLGSDAIRNGDSEGAKQSLASEDGFIESPSPVGFKISVSNPNPDIVMVGIRMHVGTTSASSIP
SEVTIFQRSIKMDEGMRCWYDIPFTVAESLLADEDVVISVGPTTSGTALPRIDSLEVYGRAKDEFGWKEKMDAVLDMEAR
VLGHGLLLPGSSKKRALAQSASMEEQVIADGLKLLSIYYSVCRPRQEVVLSELKCKQLLETIFESDRETLLQTTACRVLQ
SVFPRKEIYYQVMFLPNSVKDTMRLLGVVKVTSILSSRLGILGTGGSIVEEFNAQMRAVSKVALTRKSNFSVFLEMNGSE
VVDNLMQVLWGILESEPLDTPTMNNVVMSSVELIYSYAECLASQGKDTGVHSVAPAVQLLKALMLFPNESVQTSSRCVLV
LAISSRLLQVPFPKQTMLTTDDLVDNVTTPSVPIRTAGGNTHVMIEEDSITSSVQYCCDGCSTVPILRRRWHCTVCPDFD
LCEACYEVLDADRLPPPHTRDHPMTAIPIEVESLGADTNEIQFSADEVGISNMLPVVTSSIPQASTPSIHVLEPGESAEF
SASLTDPISISASKRAVNSLILSEFLQELSGWMETVSGVQAIPVMQLFYRLSSAIGGAFMDSSKPEEISLDKLIKWLLGE
INLSKPFAASTRSSLGEIVILVFMFFTLMLRSWHQPGSDGSSSKLGGSTDVHDRRIVQSSTVVATQSSLHVQERDDFASQ
LVRACSCLRNQEFVNYLMNILQQLVHVFKSRAANVEARGSSSGSGCGAMLTVRRDLPAGNYSPFFSDSYAKAHRADIFVD
YHRLLLENVFRLVYTLVRPEKQEKMGEKEKVYRNASSKDLKLDGFQDVLCSYINNPHTAFVRRYARRLFLHLCGSKTQYY
SVRDSWQFSNEVKNLYKHVEKSGGFENNVSYERSVKIVKSLSTIAEVAVARPRNWQKYCLRHGDFLSFLLNGVFHFAEES
VIQTLKLLNLAFYQGKDVSSSVQKAEATEVVTGSNRSGSQSVDSKKKKKGEDGHDSGLEKLYVDMEGVVDIFSANCGDLL
RQFIDFFLLEWNSSSVRTEAKSVIYGLWHHGRHSFKESLLAALLQKVRYLPAYGQNIVEYTELVSLLLDKAPENNSKQAI
NELVDRCLNPDVIRCFFETLHSQNELIANHPNSRIYSTLGNLVEFDGYYLESEPCVACSSPDVPYSKMKLESLKSETKFT
DNRIIVKCTGSYTIQSVTMNVHDARKSKSVKVLNLYYNNRPVSDLSELKNNWSLWKRAKSCHLSFNQTELKVEFPIPITA
CNFMIELDSFYENLQALSLEPLQCPRCSRPVTDKHGICSNCHENAYQCRQCRNINYENLDSFLCNECGYSKYGRFEFNFM
AKPSFIFDNMENDEDMKKGLAAIESESENAHKRYQQLLGFKKPLLKIVSSIGETEMDSQHKDTVQQMMASLPGPSCKINR
KIALLGVLYGEKCKAAFDSVSKSVQTLQGLRRVLMSYLHQKNSNFSSGASRCVVSKTPNNCYGCATTFVTQCLEILQVLS
KHPRSRKQLVAAGILSELFENNIHQGPKTARAQARAALSTFSEGDLSAVNELNNLVQKKIMYCLEHHRSMDIALATREEM
LLLSEVCSLTDEFWESRLRLVFQLLFSSIKLGAKHPAISEHIILPCLKIISVACTPPKPDTAEKEQTMGKSAPAVQEKDE
NAAGVIKYSSESEENNLNVSQKTRDIQLVSYLEWEKGASYLDFVRRQYKASQSIRGASQKSRTHRSDFLALKYTLRWKRR
SSRTSKGGLQAFELGSWVTELILSACSQSIRSEMCTLISLLAAQSSPRRYRLINLLIGLLPATLAAGESSAEYFELLFKM
IETQDALLFLTVRGCLTTICKLISQEVGNIESLERSLQIDISQGFTLHKLLELLGKFLEVPNIRSRFMRDNLLSHVLEAL
IVIRGLIVQKTKLINDCNRRLKDLLDGLLLESSENKRQFIRACVSGLQTHAEENKGRTCLFILEQLCNLICPSKPEAVYM
LILNKSHTQEEFIRGSMTKNPYSSAEIGPLMRDVKNKICQQLDLLGLLEDDYGMELLVAGNIISLDLSIAQVYELVWKKS
NQSSTSLTNSALLASNAAPSRDCPPMTVTYRLQGLDGEATEPMIKELEEDREESQDPEIEFAIAGAVREYGGLEILLDMI
KSLQDDFKSNQEEMVAVLDLLNHCCKIRENRRALLRLGALSLLLETARRAFSVDAMEPAEGILLIVESLTLEANESDSIS
AAQSALTVSNEETGTWEQAKKIVLMFLERLSHPSGLKKSNKQQRNTEMVARILPYLTYGEPAAMEALIEHFSPYLQNWSE
FDQLQQRHEEDPKDDSIAQQAAKQRFTVENFVRVSESLKTSSCGERLKDIVLENGIIAVAVKHIKEIFAITGQTGFKSSK
EWLLALKLPSVPLILSMLRGLSMGHLPTQTCIDEGGILTLLHALEGVSGENDIGARAENLLDTLADKEGKGDGFLGEKVR
ALRDATKDEMRRRALRKREELLQGLGMRQELSSDGGERIVVSQPILEGFEDVEEEEDGLACMVCREGYKLRPSDLLGVYS
YSKRVNLGVGNSGSARGECVYTTVSYFNIIHFQCHQEAKRADAALKNPKKEWEGAMLRNNESLCNSLFPVKGPSVPLAQY
LRYVDQYWDNLNALGRADGSRLRLLTYDIVLMLARFATGASFSADCRGGGRDSNSRFLPFMFQMARHLLDQGGPVQRTNM
ARSVSSYISSSSTSTATAPSSDSRPLTPGSQLSSTGTEETVQFMMVNSLLSESYESWLQHRRVFLQRGIYHTFMQHAHGR
VASRAAEPTSSGGKTQDAETLTGDELLSIVKPMLVYTGMIEQLQQLFKPKKPVHIEPIKKEGTSSGVELEPWEIVMKEKL
LNVKEMIGFSKELISWLDEINSATDLQEAFDIVGVLADVLSEGVTQCDQFVRSAIDKD*

DNA
ATGGCAGATGACTTGGCGAATCTCTGCCGATTTCTCTTCGACGACACCGCCTTTCCCTCTTTGTCGTCTTCGGCATCTTC
AGATCTCTTTTCTCGCCGTTTACGCTCCGATGATTCGATCAAGCGCGGTCTCCGTTCTTTCTATCTCCTCCTTCGCTGGG
GTGTCGCTCCGATCGGCGGAGACGATGCTGATTCCTCTGGCAAGCTACGCTTTGAGACATGGTCCGATTCGCAGCTTCAA
GCTCTTGTTTCGATATCTCAGGCGATCCTTCTACTATCTCGATCTCTATTAGGTACTGACTTGACACTGAATCAAGGTTT
AGTGGACCAACTCGAACCAATCGTTTTGGGTGTCATCCAGGAGGTGATGGAATTCTCTCTCAGCTTCTTGGAGAAGTCAA
GTTTTAGACAAAATGATCTCAAAATGGAGATCAACATGGAAATACTTTTGGAAATTGCTTCTTTTGATGGAAGTGAGAAG
CAATATGATATATTACCAGATTTCTCTCCCGCTGAAGTTGCAGAACTGTGGCCAGCTTTTTCTGGCGAGCATGATAATAT
GGACGCACAGAGCCTTGTGAAATGTACTTTTCAAGGGGGCAGATGCTCAAATGAAGAGAAGCCAGTTGACCGGCTTCTTA
TTACACTGATGTCTGAATGCATTGAATCTGATGTCCAGGCGCAGTCAGTAGTAAAGTCCCCTTTTCAACAAGACTGTGGA
GACCTGAATCCCTTTACTCGACACCTGGCAGTTGTTCACCTTCGCTGTGTTTGTCGCCTGATTATGGTCTGCAAAGAGCT
TGTTCAATTGCCAAATATGTTGGATGAGAAGACGGTTGATCAAGCTGTCCTTGATAAATTGTCGTTCTGCTTAAGAATTT
TGAAGCTGCTTGGGAGTCTTTCAAAAGATGTTCAAAGTATAGAAAACGACGGCTCATTGTTACAAGCAGTAGCTTCATTT
ACAGATGCTTTTCCTAAGCTGTTTAGGGTTTTCTTTGAATTCACTAACCACACTGCTACAGAGGGTAATATTGAGAGTCT
TTCTCTTGCGCTAGTGGAGGGATTTCTTAATCTCGTCCAACTCATTTTTGGCAAGAGCAGTGTTTTTCAGAATGTCCAGG
CATGTGTGGCAGCTTCTATTGTCAGCAATCTAGATTCCTCAGTGTGGAGATATGATGGGTCCTCTTGTAATTTGACACCT
CCACTTGCTTACTTCCCTCGGTCTGTCATCTACACATTGAAACTCATTCAAGATCTCAAGAGACAACCATACCATATCCA
TGATCTGAGGGTTTTAGAGTCTGAAGTTACCTATGAAGATGTCAGTTCCACTGTTGATTCTGTTTATTTCCATCTGCGCC
AGGAAAAGATCCCGTTGCTCAAGTGCTTCACGGTCGAGGATATAATGAGAGTGATATTTCCTTCATCAAGTCAATGGATG
GATAACTTCTTCCATCTTGTTTATTTCCTCCATCGCGAAGGTGTAAAATTACGACCAAAAGTGGAGAGGACGTATTCCAG
TTTAAGATCCAACAGTTTTGCAGAAGTTGAAAGCCAAATTTCTCATGACGATGAAGCCCTGTTTGGAAACTTATTTTCTG
AGGGTAGTCGTTCTCTCTGTTCCATAGAACCAAATGATCAACCACCTGTTTCTGTCAGCAGCAATTTACTATTGCAAGCT
GCTAAGGAACTGTTGAATTTTCTTAGAGCATGCATTCTTTGTCAAGAATGGGTTCCTAGTATATATGAAGATGGATGTAA
AAAGCTTGACACTGGTCACATTGATATCCTGCTCAATATAGTAGGCTGTAGTATTGAAGACAAGGCTTCTGATGGTGGTT
GCATGCTCCAAGATGAGGGAAGACCTGGACATGTTGCTTTTGAGCTGTTACTCAATCTCTTGAGAAGTCGTGCTCTGTCT
GATTTTCTAGAGTCCTACCTTTTTCAGCAAATTCTTGTTGTTGAAAATAGTGACTTCAACTATAATGATAAGACTCTGGC
ACTGTTGGCTCACACTCTTCTATGTAGGCCGGGCTTGGCTGGGGCACAGTTGAGAGCCAAAATTTATGATGGTTTCGTTA
GTTTTGTTACCGAGAGAGCAAGAGGTATATGTGCTGAAGCTTTGAGTCTCAAGGAGTTGACTGCTTGTCTTCCTTCTGCT
TTCCATATTGAGATTCTTCTTATGGCTTTCCATTTATCAAATGAAGCTGAGAAGGCAAAATTCTCAAATCTCATTGCTTC
ATGTCTGCATAAAGTTGATACCCCGGCAGGAATATGTGATGGTCCTCAGCTGTCCTCTTGGGCAATGCTGATATCTAGGT
TGTTAGTGCTGTTGCACCATATGTTGTTACATCCAAACACATGCCCAACATCATTAATGCTAGATCTAAGGTCTAAACTG
AGGGAAGTTCGTAGCTGTGGTAGTAATTTACATGTAACTGTTGGTGATCATTTATCTTCGTGGGCGTCTCTTGTAGCAAG
GGGTATAACTGATTCATGGGCTGAGGATGAGTCAGTCAGCCATCTAATGAGTCAAATGATTGACTTTTCCCCTCATCCTC
CTACATTTCAGAATGATGTGTCTACTGCCAAAACCTTAAACTTGGATTATGGAGATTTATCTGCGAGTTTGTGTCGGGTT
TTGGGGCTGTGGAAGGGGAAAAAGGCAGGAAAAGTGGAAGACCTGCTAGTGGAAAGATACATTTTCATGCTTTCTTCAGA
TATTGCTCGTATTAACTGTGCATTGGATAGCCAGCCTTCTTTGCATGTTAATTACCAGAATGTGGACATATCTAACTCTG
TGGATCTCATCAGCACCAGTCATTTGCTTGTAGGCGACATCAATGTTGTTGGTAGAAATATCGAGTTGAGAAACATTCTG
ATCGGTGTTTTAAATCAGCTCCAGGCAGCACCTGAGCAGGTGGTTGAGGATTTGGGTTGGGATTATATTCGCGAAGGAGC
TTGGCTCTCTCTTCTGTTGTACTTTCTTGATGGTGGCGTCTGGGATTATTGCAACAAAAATTCATGTTCAGAAATCGATC
CCTTCTGGAAGGAGTGCACATCTGTTGACGCCAAGTATGTTGCTGCAGCAGAAGGGGTAGTCTCTTACTTGATGAAGACT
GGTGATATTGCAGAATTGCTGAGAATGCTTTCATCATTGGTTGGCAAATATTTACGAGTGTATAAGAAAGCTTTCCTTGC
AACTTTCAGCGATTGGAATCATCACGGTCATAGTTCGCCTTCTCTGCTACTTCTCAAGCATACTCAATTTGGTAAAAGTC
TCCAAGGTGAATATGCGAAGATTGGTGACAATTCTCTCCATCTTCAATGCATCTTTTATCTGTCAAAACTGGATTCCCTG
GGAGATGGAAGAGGTTCGGGTGTTTTATGGAAAGTGTTTTGGGAATTTATGGTACATGGGTTTCCCACTAGTCTTCAAAC
TTCTAGTGCGATTCTTCTTTCATGTATTCTAAGCATAAGATGCATTGTGCTGACAATAAATGGCTTACTCAAACTGGGTA
ACTCTAAGGAGAAGTTTGGGGTAGATACTAGTGTACTTCATCAGCTACTTGATTCTATCATGATTATTAAGTTTGACCAG
GTATTCGAAAGCTTTCATGGGAAATGTGAGGAGATCCATCAAAATATATGTGCCGTGTTGCAGCTTCCAGATTTGACTGA
GTTGTTTCTGATGAAAGACATGGAGGGGTTTGTAAGAGATATCAGTGCTGAGCAGATAGATAGAAGCCAAGTGCTTGAAG
GGGTGATCACCAAGATTGTAGATGTTATGGACAGTCTAAGCAAGGATTCTTCGAAATCTGATATTTTCAAATTTTATCTT
GGTGTAGATGCAGTCTCTGAGCATACCAGGGAATTTTATGAGTTGCAACGTGGAGATCTGTCTGTGTTTATTGACTCATT
GGACTACTGTTCCTTGGAACCAGTAAACATAAAAGTACTTAACTTCCTTGTTGACCTTTTGTCTGTGGCTCAATCCCCTG
ATCTCCGGAGAAGAGTACAACAAAAATTTATTGACATGGATTTGATATCTTTGTCTGGGTGGCTGGAGAGAAGACTGTTG
GGTTCCTTCGTTGAAGAAATAGATGGGAAAAAGACTGCAAAAGGAAATTCTCTTCCTTTCAGAGAGGCAGCAATGAATTT
TATTAATTGTCTTGTGTCATCTACTAACGACCTACAGACCAGAGAGTTACAGAATCATTTATTCGAGGCCTTGCTGATCT
CCCTCGATACCGCGTTTCTCTCATTTGATATCCATATGTCTATGTCATATTTTCATTTTGTTCTTCAACTTGCAAGGGAA
GACAACCTGATGAAGATGGTTTTAAAGAGAACCATAATGCTGATGGAGAAGCTTGCTGCCGAGGAGAAGTTGCTTCCTGG
TTTGAAGTTTATTTTTGGTGTGATAGGCACCTTGTTGAGCAACCGTTCTCCAAGTCATGGAGAGAGTTTGTGTGGAAAGT
CCTTGGCAAGCTATAAGAATACTGCAACAGGTCCTTTGGTCCCAAAACTTTCAGGAACAACGAAAAAATCTGATACATTG
GCTCTCCCCGTGGATCAGGAAGGAAGCTCAATATCACTTGAATGCGATGTCACTTCTGTTGATGAAGATGAAGATGATGG
AACATCTGATGGTGAAGTGGCCAGCTTAGACAAGGAAGATGAAGAAGATGCCAACAGTGAGAGGTACCTTGCCTCAAAAG
TCTGCACTTTTACGTCCAGTGGCAGTAATTTCATGGAACAACACTGGTATTTTTGTTACACTTGTGACCTTACTGTGTCC
AAAGGTTGCTGTTCTGTTTGCGCGAAAGTTTGCCACCGGGGTCACCGTGTTGTCTATTCACGATCGAGTCGGTTTTTCTG
TGACTGTGGAGCTGGAGGTGTTAGGGGAAGCAGCTGCCAGTGCCTGAAGCCACGCAAATATAATGGAAATGGAAGTGCTC
CAGCTCGTGGTACAAATAATTTCCAATCGTTTTTACCCTTGTCTGAGGATGCAGATCAGCTTGGAGAAAGCGATTCGGAT
GTGGAAGAAGATGGTTTCGGGGAGGAAAATCACGTTGTCTTATATATCCCTAAAGAAACTCAATATAAGATGTCACTGCT
ACTCGAAGAGCTCGGGATAGAGGACCGAGTACTGGAGCTTTTCTCATCTTTACTTCCGTCTATCACTAGCAAAAGAGACT
CTGGCCTGTCGAAAGAGAAGCAGGTCAATCTCGGGAAAGACAAAGTTCTTTCATTTGACACGGATCTTTTGCAGCTGAAA
AAAGCATATAAAAGTGGGTCATTGGACTTAAAAATAAAGGCTGATTATACTAATTCAAAGGACCTTAAATCTCTTTTAGC
CAATGGTTCCCTTGTCAAGTCTCTCCTGAGTGTTAGTGTTCGGGGTCGCCTTGCAGTTGGAGAAGGTGATAAAGTTGCTA
TATTTGATGTTGGACAGCTAATAGGACAAGCCACAATTGCACCCATAAATGCAGACAAGGCCAACGTTAAACCACTTTCA
AGGAATATTGTTCGTTTTGAGATTGTGCATCTTTCATTCAACCCAGTTGTGGAGAATTATCTTGCTGTCGCAGGCCTTGA
AGATTGCCAGATACTTACTTTGAATCATCGAGGTGAAGTCATCGACAGGCTTGCTGTTGAGCTTGCCCTGCAAGGTGCAT
TCATCAGGCGTATAGACTGGGTTCCTGGTTCACAGGTTCAGTTAATGGTCGTTACGAACAAATTCGTGAAGATTTATGAT
CTATCCCAGGATAGCATCAGTCCAACACAGTACTTCACTTTGCCAAACGACATGATTGTGGATGCTACTCTTTTTGTTGC
TTCTCGTGGGAGGGTTTTCCTTCTTGTTCTTTCAGAACAAGGGAATTTGTATAGGTTCGAACTATCTTGGGGCGGCAATG
CAGGCGCAACACCGCTTAAGGAAATCGTTCAGATTATGGGAAAGGATGTTACGGGAAAGGGTTCATCTGTCTATTTCTCT
CCAACATATCGACTGCTTTTCATATCCTATCATGATGGAAGTTCTTTTATGGGTCGACTCAGCTCAGATGCAACATCCTT
AACTGATACATCTGGCATGTTTGAGGAAGAATCAGATTGTAAACAAAGGGTGGCTGGATTGCATCGTTGGAAAGAGTTGT
TGGCTGGCAGTGGATTATTTATTTGCTTCTCCAGCGTGAAGTCAAATGCTGTCTTAGCTGTGTCCTTGAGGGGCGATGGG
GTATGTGCACAGAATCTCCGTCATCCGACAGGATCATCTTCCCCTATGGTTGGAATAACCGCATACAAACCTTTGTCAAA
AGACAATGTTCACTGTCTAGTTCTGCATGATGATGGCAGCCTTCAGATTTATTCTCATGTTCGTAGTGGAGTTGATACTG
ACTCAAATTTCACAGCTGAAAAAGTTAAAAAGTTGGGTTCTAAGATACTTAACAACAAAACCTATGCTGGTGCAAAGCCA
GAGTTTCCCCTGGATTTCTTTGAGAGGGCATTTTGCATTACAGCAGATGTGAGACTTGGTAGTGATGCTATTAGAAATGG
TGATTCCGAGGGAGCAAAACAGAGCTTGGCATCTGAGGATGGCTTTATTGAGAGCCCCAGTCCCGTGGGCTTCAAGATAT
CTGTCTCCAATCCAAACCCTGACATTGTTATGGTTGGCATCCGGATGCATGTGGGTACTACATCAGCAAGCTCTATACCT
TCAGAAGTGACCATTTTCCAGAGATCGATTAAGATGGATGAGGGCATGAGGTGCTGGTATGACATCCCATTTACTGTGGC
TGAGTCACTTCTAGCTGATGAAGATGTTGTAATCTCTGTGGGGCCGACTACTAGTGGGACTGCACTGCCCAGAATAGACT
CGCTTGAAGTATATGGTCGAGCTAAAGATGAATTTGGCTGGAAAGAAAAAATGGATGCTGTGCTAGATATGGAAGCTCGT
GTGCTTGGTCATGGTTTGCTTCTTCCAGGCTCTAGTAAAAAGAGAGCGTTGGCACAGTCTGCTTCAATGGAAGAGCAAGT
TATCGCTGATGGTCTTAAGCTCCTATCAATCTATTATTCAGTTTGTAGGCCACGGCAAGAAGTAGTGCTTAGCGAACTCA
AATGCAAACAGCTACTAGAGACGATTTTCGAAAGTGATAGGGAAACCCTATTACAAACGACAGCTTGCCGTGTTTTGCAG
TCTGTCTTTCCAAGAAAGGAGATATACTACCAGGTAATGTTTCTACCAAATTCAGTCAAAGACACCATGCGACTCCTTGG
AGTGGTCAAGGTGACCTCCATTCTTTCTTCGAGGTTGGGGATTTTGGGTACTGGAGGTTCGATTGTTGAAGAGTTCAATG
CTCAGATGCGGGCGGTGTCTAAAGTAGCTTTGACCCGTAAATCAAATTTCTCCGTCTTTCTGGAGATGAATGGCTCTGAA
GTGGTTGATAATCTGATGCAAGTGCTATGGGGAATTTTGGAGTCAGAGCCACTCGACACACCTACTATGAACAATGTCGT
GATGTCCTCCGTTGAACTAATCTATAGCTATGCAGAGTGTTTGGCATCTCAAGGAAAGGATACAGGGGTTCATTCTGTAG
CTCCTGCAGTTCAGTTACTGAAAGCACTTATGTTGTTTCCCAATGAGTCTGTGCAAACATCCAGCAGGTGTGTTCTTGTC
CTAGCTATATCATCAAGGTTACTTCAGGTTCCTTTCCCAAAGCAAACAATGTTGACAACAGATGATTTGGTTGACAATGT
TACAACTCCTTCGGTGCCTATCAGAACAGCTGGTGGAAATACACATGTCATGATTGAGGAGGACTCTATAACTTCATCTG
TTCAATACTGCTGTGATGGCTGCTCCACCGTCCCTATACTGAGAAGAAGGTGGCACTGCACTGTTTGTCCAGATTTTGAT
CTATGTGAGGCATGCTATGAAGTGTTAGATGCAGATCGTCTACCACCACCACACACTCGAGATCATCCTATGACAGCAAT
TCCAATAGAAGTGGAATCACTTGGTGCAGACACCAATGAGATTCAGTTCTCTGCGGATGAAGTAGGTATTTCAAATATGT
TGCCGGTGGTAACCAGTAGCATTCCACAAGCTTCAACTCCCTCCATCCATGTCTTGGAACCTGGTGAATCTGCTGAGTTC
TCTGCCTCACTGACCGATCCTATTTCTATCTCAGCGTCAAAGCGTGCCGTAAATTCTTTGATTCTCTCTGAGTTTCTCCA
AGAGTTGAGTGGATGGATGGAAACAGTATCCGGTGTTCAAGCTATTCCTGTGATGCAATTGTTCTACAGATTATCATCTG
CCATTGGTGGAGCCTTTATGGATAGCTCAAAGCCCGAAGAAATAAGCTTGGATAAGTTAATTAAATGGCTTTTGGGTGAA
ATCAATCTCAGCAAGCCGTTTGCTGCTTCAACTCGCTCTTCCTTAGGGGAAATTGTGATTCTTGTGTTTATGTTTTTCAC
CTTGATGCTTCGGAGTTGGCACCAGCCTGGTAGTGATGGTAGTAGCTCCAAATTAGGTGGAAGTACAGATGTACATGACC
GGAGGATTGTCCAGAGCTCCACTGTAGTAGCTACTCAGTCTTCTTTACATGTTCAAGAGAGAGATGACTTTGCATCTCAG
CTAGTTCGTGCGTGCAGTTGCCTCAGGAACCAAGAGTTTGTTAATTATCTGATGAACATACTTCAACAGCTAGTGCATGT
TTTTAAGTCACGTGCTGCCAATGTTGAAGCTCGTGGATCAAGCTCTGGTTCTGGTTGTGGAGCCATGCTCACAGTCAGAA
GAGATTTACCTGCGGGTAACTATTCTCCCTTCTTTTCGGATTCATATGCAAAAGCCCATAGAGCAGATATTTTTGTGGAC
TATCACAGGCTGCTACTTGAGAATGTGTTTCGCTTAGTATATACCTTAGTTAGACCTGAAAAACAAGAGAAAATGGGGGA
AAAGGAAAAGGTATACAGGAATGCTTCTTCTAAAGATTTAAAGCTGGACGGTTTCCAGGATGTTCTATGCAGCTATATAA
ATAACCCTCATACGGCTTTTGTTAGGAGATATGCTAGAAGGCTGTTTTTGCATCTTTGCGGAAGCAAAACTCAATACTAC
AGTGTCAGAGATTCATGGCAGTTTTCCAATGAAGTGAAAAACCTATACAAGCATGTTGAAAAGTCTGGTGGTTTTGAAAA
CAATGTTTCATATGAAAGAAGTGTAAAGATTGTGAAGTCGCTTTCTACAATTGCTGAAGTTGCTGTGGCAAGACCTCGGA
ACTGGCAGAAGTACTGTCTCAGGCATGGAGATTTTCTGTCCTTCCTACTGAATGGTGTATTCCATTTTGCGGAAGAGTCT
GTAATCCAGACACTTAAACTCCTCAATTTGGCCTTTTATCAAGGAAAAGATGTGAGCAGCTCAGTGCAGAAAGCTGAAGC
AACTGAAGTAGTGACAGGCTCAAACCGGTCAGGATCTCAGTCAGTGGATTCAAAAAAGAAGAAAAAAGGTGAAGATGGGC
ATGATTCGGGTTTGGAAAAATTATATGTGGATATGGAAGGGGTGGTCGATATCTTCAGTGCCAATTGCGGAGATCTCTTG
AGGCAGTTTATTGATTTCTTTCTGCTGGAATGGAATTCGAGCTCTGTTCGCACTGAAGCAAAATCTGTTATTTATGGCTT
GTGGCATCATGGAAGACACTCGTTCAAAGAAAGTCTGTTAGCAGCTCTTTTGCAGAAGGTTAGATACCTGCCAGCATATG
GTCAGAATATTGTTGAGTACACAGAACTTGTCTCCTTGTTGCTTGACAAGGCTCCAGAAAACAACTCAAAGCAAGCAATT
AATGAGCTTGTGGATCGGTGCCTGAACCCTGATGTGATAAGGTGCTTTTTTGAGACGCTGCATTCCCAGAACGAACTCAT
TGCCAATCATCCAAACTCCCGTATATACAGCACTCTGGGTAATCTTGTGGAATTTGATGGTTATTATCTTGAGAGCGAAC
CTTGTGTTGCCTGCAGTTCTCCTGATGTGCCATATAGCAAAATGAAGCTTGAAAGTTTGAAATCCGAGACAAAGTTTACT
GATAACCGCATCATTGTGAAATGTACTGGGAGTTATACGATACAGTCTGTGACAATGAATGTTCATGATGCACGAAAGTC
AAAGTCGGTGAAGGTCCTAAACTTGTATTACAACAATCGCCCTGTCTCGGATTTATCAGAGCTTAAAAACAACTGGTCAC
TGTGGAAGCGTGCCAAAAGTTGTCATCTGTCTTTTAACCAAACTGAACTGAAGGTGGAATTTCCTATTCCTATTACTGCT
TGTAACTTCATGATCGAGTTGGATTCTTTCTATGAGAATCTTCAGGCGTTATCTCTTGAACCATTGCAATGTCCTCGATG
CAGCCGACCTGTCACTGATAAACATGGTATTTGCAGCAACTGCCATGAGAATGCTTATCAGTGCAGGCAATGCCGTAACA
TTAATTATGAAAATTTGGATTCATTCCTTTGCAACGAGTGTGGCTACAGCAAGTATGGGAGGTTTGAGTTTAACTTCATG
GCAAAACCAAGCTTCATATTTGATAATATGGAAAATGACGAAGATATGAAGAAGGGATTGGCTGCTATAGAGTCTGAGTC
TGAAAACGCTCACAAGAGATATCAGCAACTACTGGGATTCAAGAAGCCGCTTCTGAAGATAGTTTCAAGCATTGGTGAAA
CTGAAATGGATTCGCAGCACAAGGACACTGTCCAGCAAATGATGGCATCTTTACCTGGTCCATCATGCAAGATAAACCGC
AAAATCGCACTTTTGGGCGTACTGTATGGTGAGAAGTGCAAAGCTGCTTTTGATTCTGTCAGCAAAAGTGTACAAACACT
GCAGGGGCTTCGTAGAGTTTTGATGAGCTACCTCCATCAGAAAAATTCAAATTTTTCATCAGGTGCCTCAAGATGTGTGG
TCTCAAAGACCCCAAACAATTGTTATGGTTGTGCAACTACATTTGTCACTCAATGTCTTGAGATTCTTCAAGTGCTGTCG
AAGCATCCAAGATCTAGAAAACAACTTGTTGCAGCTGGTATTTTGTCTGAGTTGTTTGAAAACAATATTCACCAAGGTCC
GAAAACAGCCCGTGCTCAAGCTAGAGCAGCTCTTTCTACTTTCTCGGAGGGTGATCTGAGTGCAGTGAATGAGTTAAACA
ATCTGGTACAGAAGAAAATAATGTACTGCCTTGAACACCATCGTTCCATGGATATTGCGCTCGCCACTCGTGAGGAAATG
TTGTTGCTTTCAGAAGTTTGCTCTCTCACTGATGAATTCTGGGAGTCAAGACTGCGCCTTGTTTTTCAGCTACTATTTTC
ATCCATTAAATTGGGTGCTAAACATCCTGCTATATCAGAGCACATAATTCTTCCTTGCCTTAAGATTATTTCTGTGGCAT
GTACACCTCCAAAACCAGATACGGCAGAGAAAGAGCAAACGATGGGAAAATCTGCTCCTGCAGTGCAAGAAAAGGATGAG
AATGCTGCTGGCGTCATAAAGTATTCATCAGAAAGCGAAGAAAATAACCTGAATGTATCTCAGAAGACGCGAGATATTCA
GCTTGTGAGTTATTTGGAATGGGAGAAAGGGGCATCATATCTCGACTTTGTGAGGAGGCAATACAAAGCCTCTCAGTCAA
TTAGAGGTGCGAGCCAAAAGTCTAGAACCCACAGATCAGATTTCTTGGCACTTAAATATACACTTAGGTGGAAGCGACGG
TCTAGCAGGACATCTAAAGGTGGTTTACAGGCATTTGAGCTCGGGTCGTGGGTCACAGAGCTTATTCTTAGTGCATGTTC
TCAATCTATCAGGTCGGAGATGTGCACATTGATTAGTTTACTCGCTGCCCAAAGCTCACCTAGGCGCTACAGGCTGATTA
ATTTGCTGATAGGCTTGCTTCCCGCTACGCTTGCAGCGGGTGAAAGTAGCGCAGAATACTTTGAGCTACTCTTCAAAATG
ATTGAGACACAAGATGCACTTCTTTTCTTAACTGTCCGGGGTTGTCTGACAACAATCTGTAAATTGATCTCCCAAGAGGT
GGGAAACATTGAATCTCTAGAAAGGAGTCTTCAGATTGACATTTCACAGGGATTTACCCTCCACAAGCTCTTAGAACTCC
TTGGAAAGTTCTTAGAGGTTCCAAATATTCGTTCCAGATTCATGAGAGACAATTTACTGTCTCATGTTCTGGAGGCCCTC
ATTGTAATTCGTGGCTTGATAGTGCAAAAGACAAAGCTTATAAATGATTGCAACAGACGCCTAAAAGATCTTCTTGACGG
ACTTCTGCTTGAAAGCAGTGAAAATAAACGTCAATTTATCCGTGCCTGTGTTTCTGGACTGCAAACCCATGCAGAGGAGA
ACAAAGGACGTACCTGTTTGTTTATTCTTGAGCAACTTTGTAATCTGATCTGCCCGTCAAAACCTGAGGCTGTGTATATG
CTGATCTTGAACAAATCACACACGCAAGAGGAGTTTATCCGGGGATCAATGACAAAAAATCCATATTCGAGTGCTGAGAT
TGGCCCACTGATGCGGGATGTGAAAAACAAGATTTGTCAGCAGTTGGACCTGCTAGGTCTACTGGAAGATGACTATGGCA
TGGAGTTGCTTGTAGCAGGAAACATCATTTCACTAGACCTGAGCATAGCTCAAGTTTATGAGCTAGTTTGGAAGAAATCA
AATCAGTCTTCTACTTCACTGACCAACTCCGCACTGTTAGCTTCAAATGCAGCTCCCAGCAGGGATTGCCCTCCCATGAC
GGTGACATACAGACTTCAGGGGTTAGATGGTGAAGCTACTGAGCCTATGATCAAGGAATTGGAAGAAGATAGAGAAGAAT
CACAAGATCCAGAGATTGAGTTTGCAATAGCAGGTGCAGTTCGAGAATATGGTGGTCTGGAAATTTTACTTGATATGATC
AAGAGTTTACAAGATGACTTCAAATCCAACCAAGAAGAGATGGTTGCAGTTCTTGATCTCCTAAACCATTGCTGCAAGAT
TAGAGAGAACAGGCGAGCTCTACTCAGGCTAGGGGCTTTAAGCTTACTTCTTGAAACAGCTAGGAGGGCATTTTCTGTGG
ATGCTATGGAGCCAGCTGAAGGCATACTCTTAATTGTCGAGAGTTTGACGCTTGAAGCAAATGAAAGTGACAGCATCAGT
GCCGCACAAAGTGCTTTGACTGTCAGTAACGAGGAAACTGGAACTTGGGAACAGGCCAAAAAAATAGTGCTTATGTTCTT
AGAAAGGCTAAGCCATCCTTCAGGGCTTAAAAAGTCAAACAAACAGCAAAGGAACACGGAGATGGTTGCTAGAATCTTAC
CTTACTTAACATACGGTGAGCCTGCAGCGATGGAAGCACTCATAGAGCATTTTAGCCCTTACCTGCAAAACTGGTCTGAA
TTTGATCAGCTTCAGCAACGTCATGAGGAGGACCCCAAGGATGACAGCATTGCTCAGCAAGCGGCGAAGCAGAGGTTTAC
TGTGGAGAATTTTGTAAGAGTGTCAGAATCTCTCAAGACAAGTTCATGTGGAGAGAGGTTAAAAGACATAGTTTTGGAGA
ATGGTATCATAGCTGTTGCTGTCAAACACATAAAGGAAATTTTTGCAATCACGGGACAGACTGGGTTCAAATCTAGCAAG
GAATGGCTTTTGGCTCTTAAACTTCCGTCAGTGCCTCTTATTTTGTCAATGCTAAGAGGATTGTCGATGGGTCATTTGCC
TACCCAAACATGCATAGACGAGGGAGGAATTTTAACCCTACTTCATGCCTTAGAAGGAGTCTCTGGAGAAAACGACATCG
GTGCAAGGGCTGAAAATTTGCTAGATACACTTGCCGATAAAGAAGGAAAAGGAGATGGATTTCTTGGAGAGAAAGTCCGT
GCATTACGAGATGCCACCAAAGATGAAATGAGACGCCGTGCATTAAGAAAGAGAGAGGAGCTCCTGCAGGGACTTGGAAT
GCGTCAAGAGCTATCTTCTGATGGTGGTGAAAGGATTGTGGTTTCTCAACCAATTCTTGAAGGTTTTGAGGATGTAGAGG
AAGAAGAAGATGGATTGGCTTGCATGGTGTGTAGAGAAGGCTACAAGCTCAGACCTTCTGATTTATTAGGAGTCTACTCT
TACAGCAAACGGGTGAATCTCGGTGTTGGCAATTCTGGAAGCGCACGTGGTGAATGCGTTTACACTACAGTGAGCTACTT
CAACATAATTCATTTTCAATGTCATCAAGAGGCAAAAAGAGCCGACGCTGCTCTTAAAAATCCGAAGAAAGAATGGGAAG
GAGCTATGTTGCGTAACAATGAATCTCTTTGCAACTCTCTCTTCCCTGTCAAGGGTCCCTCAGTTCCCTTAGCACAGTAT
CTTCGTTACGTTGACCAGTACTGGGATAATCTCAATGCTCTTGGTCGAGCCGACGGAAGCAGACTCCGTCTATTGACGTA
CGACATTGTCCTGATGCTGGCTCGGTTTGCAACAGGAGCTTCTTTTAGCGCGGATTGCCGAGGTGGAGGAAGAGATAGCA
ATTCCCGTTTCTTGCCTTTCATGTTCCAAATGGCCCGTCATCTTCTCGACCAAGGAGGCCCCGTGCAACGCACAAACATG
GCTAGATCTGTTTCATCGTACATTTCATCATCATCGACATCTACAGCAACAGCGCCATCCTCGGACTCGCGACCTTTAAC
TCCTGGATCCCAGCTATCATCAACTGGAACAGAGGAAACGGTTCAGTTCATGATGGTAAACTCGCTTCTATCAGAATCAT
ATGAATCATGGCTCCAACACCGTAGGGTCTTTCTCCAGCGGGGGATTTACCATACTTTCATGCAACACGCTCACGGTCGG
GTAGCTTCTCGCGCTGCAGAACCAACCAGTTCAGGAGGCAAAACCCAAGACGCAGAAACCTTAACCGGCGATGAACTTCT
CTCTATCGTCAAACCAATGCTGGTCTACACCGGTATGATCGAACAGCTTCAACAGTTGTTCAAACCCAAGAAACCGGTCC
ACATCGAACCAATCAAGAAAGAAGGTACATCAAGTGGAGTAGAGCTTGAGCCATGGGAGATTGTAATGAAAGAGAAGCTG
CTGAATGTGAAAGAAATGATTGGTTTCTCCAAGGAATTGATCTCGTGGCTCGACGAAATCAACTCTGCAACTGATCTACA
AGAAGCATTTGATATTGTCGGCGTTTTGGCTGATGTTTTGTCTGAAGGAGTTACACAGTGTGATCAGTTTGTGAGATCGG
CGATCGATAAAGATTGA