Details for Arabidopsis Locus AT3G02200

Position : Chr3 ( 5`- 406594 .. 409163 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02200

Protein [Map View]
MTTIVPTSEENPFLAVVRFTSQLAWADAGPEAAEPEITRLCREAEESMVAEKWLELSSLMVTSAELVSSKISEKDLECTY
TIICSIVKNAKSPEQVLEMVKAIASKVAQQPSDKASLRLKILFNLYNLVDHPYARFQVYMKALTLAVDGKVTEYIVSSFK
KIDNFLKEWNIDIKDQRELFLAIANVLKENKSLVNESLKFLTKYLATFSNEDAQVLDEAKEEAVRAVIEFVKASSIFQCD
LLDLPAVAQLEKDAKYAPVYQLLKIFLTQRLNAYTEFQNANSGFLQSYGLSNEDCVTKMRLLSLVDLASDESGKIPYTSI
KDTLQVNEQDVELWIVKAITAKLIECKMDQMNQVLIVSRSSEREFGTKQWQSLRTKLATWKDNISSIITTIESNKVTEEG
SQASSSSAAAIQGLSVR*

DNA
ATGACGACGATTGTTCCCACCTCCGAAGAAAATCCCTTTCTCGCTGTTGTCCGATTCACTTCCCAGCTCGCCTGGGCCGA
TGCTGGTCCCGAGGCAGCAGAGCCAGAAATTACCAGGCTCTGTAGGGAGGCTGAGGAGTCAATGGTAGCAGAGAAGTGGC
TTGAATTGTCTTCGTTAATGGTCACTTCAGCTGAATTGGTATCTTCTAAGATATCTGAGAAAGATCTTGAGTGTACCTAC
ACCATCATTTGCAGCATTGTCAAGAATGCGAAAAGCCCTGAGCAAGTCCTTGAAATGGTGAAAGCTATAGCTTCCAAGGT
TGCTCAACAACCCAGTGACAAAGCTTCACTTCGTTTGAAGATCCTCTTCAATCTCTATAACCTGGTTGACCACCCGTATG
CTCGATTTCAAGTATACATGAAAGCTCTTACACTAGCTGTTGATGGGAAGGTTACTGAGTACATAGTTTCTTCTTTTAAG
AAGATCGATAACTTTCTGAAAGAGTGGAATATTGACATTAAAGATCAGAGGGAACTCTTTCTTGCCATTGCTAATGTGCT
GAAAGAAAACAAAAGCTTGGTGAATGAATCCCTTAAGTTCTTGACGAAGTACCTAGCAACTTTCTCCAATGAGGATGCTC
AGGTCCTGGATGAAGCCAAGGAGGAGGCTGTGCGTGCAGTTATCGAATTTGTCAAAGCTTCCAGTATTTTCCAGTGTGAT
TTATTGGACTTGCCAGCCGTAGCACAATTGGAAAAGGATGCTAAATATGCACCTGTTTACCAACTTCTGAAGATTTTTCT
TACTCAGAGGTTAAATGCCTACACGGAATTCCAAAATGCAAATTCGGGATTTCTGCAAAGCTATGGACTTTCCAATGAAG
ATTGTGTTACGAAGATGAGGTTGTTGTCACTAGTGGATTTGGCCTCAGATGAATCTGGCAAAATACCTTACACCTCGATT
AAAGACACTCTTCAGGTAAATGAACAGGATGTCGAGTTATGGATCGTGAAGGCAATAACTGCAAAACTGATTGAGTGTAA
GATGGATCAGATGAACCAAGTTTTAATTGTCAGCCGCTCTTCCGAACGTGAATTTGGGACAAAGCAATGGCAATCTCTCC
GAACAAAGCTTGCGACTTGGAAGGACAACATTTCAAGTATCATAACTACCATCGAATCGAATAAGGTAACGGAGGAAGGT
TCTCAGGCATCATCATCATCTGCTGCAGCTATTCAAGGCTTGAGTGTTCGTTGA