Details for Arabidopsis Locus AT3G02190

Position : Chr3 ( 5`- 405816 .. 406401 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02190

Protein [Map View]
MPSHKSFMIKKKLGKKMRQNRPIPNWIRLRTDNKIRYNAKRRHWRRTKLGF*

DNA
ATGCCGTCGCACAAGTCGTTCATGATCAAAAAGAAGCTAGGGAAGAAGATGAGACAGAACAGACCGATCCCTAATTGGAT
CCGTCTCCGTACTGATAACAAAATCAGGTACAACGCTAAGCGTAGGCACTGGCGCCGTACCAAGCTAGGATTCTAG