Details for Arabidopsis Locus AT3G02125

Position : Chr3 ( 5`- 378205 .. 379612 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G02125

Protein [Map View]
METKTENKEHQWKDSVSSRSSSRSSSITSASSDGHFDIRHFPLPKPSLSASEAQKLRESHQAYNSSVSSYTSSSWSSNHQ
NHLIDLPGYDPTRIPSSVFSSKPGNSTEWSLASNESLFSIHDGNFSISTALRLAEIPRFEETVHVITEINSVPLPPPVKK
PNEYEKETIAEKEPYQVENSNSDIEDNEEEEKMSEVESDDEHEEEQTDMIEAEALVEKEVIETVKENKPEDSNSIVSHSP
SISCRSDTSNNSIGSFAFPLLQKEDAVTKTPSMQIKGNVSHKRRPEYQLPQSRMLQPQQQLQPYSESNMLTESQPEPQPQ
RKASKKFESRTQSLKASRTCWFSCFHCPSKCGSFK*

DNA
ATGGAAACAAAAACTGAAAACAAAGAACATCAATGGAAGGATTCAGTTTCTTCAAGGTCATCTTCACGATCGTCATCGAT
AACATCTGCTTCTTCGGATGGACACTTTGATATCCGACACTTTCCTCTTCCCAAGCCATCATTGTCTGCTTCTGAGGCAC
AGAAACTGAGAGAGTCACATCAGGCTTATAATTCATCTGTTAGCTCATATACCAGTTCCTCTTGGTCCTCAAATCACCAG
AACCATCTTATTGATTTACCCGGTTACGATCCAACCAGAATTCCATCCTCAGTTTTCTCTAGTAAACCGGGTAATTCGAC
GGAATGGAGTCTAGCTTCTAATGAATCTTTGTTTAGCATCCACGATGGGAATTTTAGCATTTCAACAGCGTTGAGATTGG
CTGAGATACCGAGATTTGAAGAAACGGTTCACGTGATAACCGAAATCAACTCGGTTCCTCTTCCACCTCCGGTTAAGAAA
CCAAATGAATATGAGAAAGAGACGATTGCAGAGAAGGAACCATACCAGGTGGAGAACTCAAACTCAGATATTGAGGATAA
TGAAGAAGAAGAGAAGATGAGTGAAGTCGAGAGCGACGACGAACATGAAGAAGAACAAACAGATATGATCGAAGCGGAGG
CTTTAGTAGAGAAAGAAGTAATAGAAACTGTGAAGGAGAATAAACCTGAAGACTCGAACAGTATAGTTTCACATTCTCCG
AGCATTTCTTGTCGTTCGGACACTAGCAATAACAGCATTGGTTCTTTCGCATTCCCACTATTGCAAAAAGAAGATGCAGT
TACCAAAACGCCGTCTATGCAAATCAAAGGAAACGTTTCCCACAAGCGAAGACCCGAGTATCAGCTGCCTCAATCGCGAA
TGCTACAGCCACAACAACAACTACAACCTTATTCAGAATCTAATATGCTAACTGAGTCTCAGCCGGAACCACAACCACAA
AGGAAGGCATCAAAAAAATTCGAGTCTCGAACGCAATCGCTAAAAGCTTCAAGAACCTGCTGGTTCTCTTGCTTCCATTG
TCCTTCAAAATGCGGTTCATTCAAGTAG