Details for Arabidopsis Locus AT3G01960

Position : Chr3 ( 5`- 324581 .. 325087 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01960

Protein [Map View]
MEMNRRRSRGFMIAKLMPFCKAVKSPTPSQDLYNNVHYTSSTTTSYARQPDFNNYVTATTPLPPKVSFLLQPSLAPEGKD
MEKKLNMMAEKLIGRGINGVDDCVDARAASYISSVRERFKADQYCEKLTTVISLDDEN*

DNA
ATGGAGATGAACAGAAGGAGATCAAGAGGGTTCATGATAGCTAAGCTAATGCCCTTTTGCAAAGCTGTGAAATCTCCAAC
TCCTTCCCAAGACCTTTATAATAATGTTCATTACACTTCTTCCACTACGACTTCCTACGCTCGTCAACCTGATTTCAACA
ACTACGTAACTGCCACTACGCCTCTCCCTCCTAAAGTTAGCTTCCTCCTTCAACCATCCTTGGCTCCTGAGGGTAAGGAT
ATGGAAAAGAAGCTGAACATGATGGCAGAGAAGCTGATCGGCAGAGGTATTAACGGAGTGGACGACTGCGTTGACGCTAG
AGCCGCTTCTTATATCTCTTCGGTTCGAGAGAGGTTTAAGGCGGACCAATATTGTGAGAAACTGACGACTGTTATTAGCT
TAGATGATGAAAATTGA