Details for Arabidopsis Locus AT3G01950

Position : Chr3 ( 5`- 323977 .. 324365 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01950

Protein [Map View]
MGLDWGPVLMSVIFFIVLSPGVLFQLPGKSKAVEFGGFQTSGPSIVIHTLLFFAFITISLIALHIHIYAA*

DNA
ATGGGGTTGGACTGGGGACCGGTGCTAATGTCGGTAATTTTCTTCATCGTGTTGAGCCCTGGAGTTTTGTTTCAGCTGCC
CGGAAAGAGCAAAGCGGTTGAGTTCGGTGGGTTTCAGACAAGCGGCCCCTCCATTGTCATCCACACTCTCCTCTTCTTCG
CCTTCATCACCATCTCCCTCATCGCCCTTCACATCCACATCTACGCCGCCTAA