Details for Arabidopsis Locus AT3G01900

Position : Chr3 ( 5`- 312359 .. 313849 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01900

Protein [Map View]
MEASTFILLLVLVLLLVSAGKHVIYSCRNSTPKTYPVIGCLISFYTNRNRLLDWYTELLTESPSRTVVIRRLAARRTVVT
ANPSNVEYILKTNFDNYPKGKPFTEILGDFLGNGIFNVDGNLWLKQRRLATHDFTPKSLREYVTVLRNEVEKELLAFLNA
AAEDSQPFDLQELLRRFTFNIVCIVFLGIDRCTLNPSSPVSEFDRAFQTASAVSAGRGSAPLSFVWKFKRLVGFGSEKEL
RKAVGEVHNCVDEIIRDKKRKPANQDFLSRLIVAGESDETVRDMVISIIMAGRDTTSAVATRLFWLITGHEETEHDLVSE
IRSVKEEITGGFDYESLKKLSLLKACLCEVMRLYPPVPWDSKHALTDDRLPDGTLVRAGDRVTYFPYGMGRMEELWGEDW
DEFKPNRWAESYDKTCCRVLKKVNPFKFPVFQAGPRVCLGEEMAYVQMKYIVASILDRFEIEPIPTDKPDFVPMLTAHMA
GGMQVRVHRRDPSLSP*

DNA
ATGGAAGCTTCAACTTTTATTCTTCTTCTTGTCCTTGTGCTGTTGCTTGTCTCTGCGGGAAAACATGTGATATATTCTTG
CCGCAACTCTACACCGAAAACATACCCGGTTATCGGATGCTTAATTTCATTCTATACCAACCGAAACCGGTTACTGGATT
GGTATACAGAGCTCCTAACCGAATCCCCGAGTCGGACGGTAGTCATTCGCCGCTTAGCTGCACGGAGAACCGTAGTGACG
GCGAACCCCTCGAACGTGGAGTATATCCTCAAAACAAACTTCGACAACTATCCCAAAGGCAAACCTTTTACGGAGATCCT
CGGAGATTTTCTCGGCAACGGGATCTTCAACGTTGACGGAAACCTCTGGTTAAAGCAGAGGAGACTTGCTACACACGACT
TCACCCCAAAGTCGCTGAGAGAATACGTCACCGTTTTGAGAAACGAGGTGGAGAAGGAGCTCTTAGCGTTTCTAAACGCA
GCTGCGGAAGATTCACAACCCTTCGATCTTCAGGAGCTTCTCCGTAGATTCACTTTCAATATTGTTTGCATTGTTTTCCT
CGGGATCGATCGTTGCACTTTAAACCCTTCCTCCCCCGTTTCTGAGTTCGACAGAGCCTTTCAGACAGCTTCTGCGGTCA
GCGCTGGACGCGGTTCCGCACCGCTGTCTTTTGTGTGGAAGTTTAAGAGACTGGTCGGTTTTGGATCTGAGAAAGAGCTC
AGAAAAGCCGTCGGAGAAGTCCATAACTGCGTCGATGAGATCATTCGGGATAAGAAGAGGAAGCCTGCCAACCAAGACTT
TCTCTCGCGGTTGATCGTCGCCGGAGAAAGCGACGAGACGGTGAGAGATATGGTAATAAGTATCATAATGGCGGGGAGGG
ACACCACGTCGGCGGTAGCCACACGGCTGTTTTGGTTGATCACCGGTCACGAGGAAACCGAGCACGATCTGGTTAGTGAA
ATCCGATCGGTCAAGGAGGAGATAACGGGGGGTTTTGATTACGAATCATTGAAGAAACTGAGTTTGTTGAAAGCGTGTTT
GTGTGAAGTGATGCGATTGTATCCTCCGGTGCCGTGGGACTCCAAACACGCCTTAACCGATGACCGGTTACCAGACGGTA
CGTTGGTGCGTGCCGGAGACCGGGTAACGTATTTTCCATATGGTATGGGGAGAATGGAAGAGCTATGGGGGGAAGATTGG
GATGAGTTTAAACCAAACCGGTGGGCTGAGTCTTATGATAAAACCTGCTGCAGAGTTTTGAAAAAGGTGAATCCGTTCAA
GTTTCCGGTTTTCCAAGCCGGCCCAAGGGTTTGTCTTGGGGAAGAGATGGCGTACGTGCAGATGAAGTATATTGTGGCTT
CCATACTTGACCGGTTTGAGATTGAACCGATCCCTACGGATAAACCGGATTTTGTGCCAATGCTCACGGCTCACATGGCT
GGTGGGATGCAAGTCCGCGTTCATCGGAGAGATCCTTCTCTTTCCCCTTGA