Details for Arabidopsis Locus AT3G01840

Position : Chr3 ( 5`- 296582 .. 298648 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01840

Protein [Map View]
MAVSVSKQYMTSLVVILLFISLSSLSPTSTSHSCDPVEEEEEASSFGYVCHSNLQKCHTFAILRAKPPFYSLSDLSRHLG
LDADDEYVPKGQLLLIPIECRCNGSIYEASLIKNCVKGDTFRSVSQSLQGLTTCLSIREKNPHISEDKLGDNIKLRLAIR
CSCPQEGVSNASFLVTYPVGVRDSVSSLAVRFNTTEDAIVSANNKSGVVPLKPALIPLDHKPEKQGSRKRNPSKKKRSKM
KLMIAVSSAIAGVCGLVTLMVFGYLHWKKETQIQTQTQKWISNKDPETRQLSLSIRTTSDKKISFEGSQDGSILDSHNTV
GTTTPRKPVLEIYAFEELEKATENFSSSNHIKGSVYFGSLKGKDLAIKQVNADEMKRFDFGLLNDQSHYYNHNVIRVLGT
CFREIDQDSYLVFEYARNGSLWDWIQNKLAIKNQFIESCYCFLAWKQRIKICHDVAIALKYMHRINYVHGNIKSRNIFLN
EDLRGKVGNFGMSKCVTNELATEENLIESSLSPASDIFAYGIIVMEVLSGQTPDMLLGLQEVETTSLGTQETFVSEWSRL
RRLLGDKEKLREVMDSTLGESYSVDSAFEIASIARDCTAEEAESRPSAVEIAERVSRLVDDDEDEEDEAVIDRESTLISE
SSYKPLVKKSSIID*

DNA
ATGGCTGTTTCAGTTAGTAAGCAGTACATGACAAGTCTTGTAGTGATCTTGCTCTTCATCTCCTTATCATCTCTCTCTCC
AACTTCAACTTCACACAGCTGTGACCCTGTCGAAGAAGAAGAAGAAGCCTCCTCCTTCGGTTACGTTTGCCACTCAAACC
TCCAAAAGTGCCACACTTTCGCCATTCTCAGAGCCAAACCTCCCTTCTATTCCCTCTCGGACCTGAGTCGCCATCTTGGT
CTCGACGCAGACGACGAGTATGTTCCGAAAGGTCAGTTACTCTTGATCCCAATAGAGTGCAGGTGTAATGGAAGCATCTA
CGAGGCCAGTCTCATTAAAAATTGCGTTAAAGGAGACACCTTTCGCTCTGTCTCTCAGTCTCTGCAAGGCTTGACCACCT
GCCTATCTATCAGAGAGAAGAATCCACATATTTCCGAAGACAAGCTTGGCGACAACATTAAACTGCGTTTGGCGATCAGG
TGCTCTTGTCCACAAGAAGGCGTTTCAAACGCTAGTTTTCTCGTTACGTATCCGGTGGGCGTCCGCGACAGCGTTTCAAG
CCTGGCGGTTAGGTTTAACACAACAGAGGATGCCATTGTCTCTGCAAACAACAAATCTGGTGTGGTTCCACTCAAGCCTG
CTCTCATCCCTCTTGATCACAAACCAGAGAAACAAGGATCCCGGAAAAGAAATCCATCCAAGAAGAAACGGTCAAAGATG
AAGCTCATGATCGCTGTGAGCAGCGCGATTGCTGGAGTTTGCGGTCTTGTCACTCTCATGGTGTTTGGTTACTTACACTG
GAAGAAAGAGACGCAGATTCAAACGCAAACGCAAAAGTGGATTAGCAACAAAGACCCCGAGACGCGGCAGCTGAGTCTGA
GCATCCGAACCACGAGTGACAAGAAAATCTCGTTTGAAGGGTCGCAGGACGGTTCCATCTTGGATTCTCACAACACCGTC
GGCACCACAACGCCCCGAAAACCCGTTCTGGAGATTTACGCGTTTGAAGAGTTAGAGAAGGCCACGGAGAATTTCAGTTC
AAGCAATCACATCAAAGGTTCGGTTTATTTCGGTTCGCTCAAAGGCAAAGACTTGGCTATAAAGCAAGTCAATGCAGATG
AAATGAAAAGATTCGATTTCGGGCTTCTCAATGATCAGTCACACTACTATAACCACAATGTGATTAGGGTTCTTGGAACA
TGTTTTAGAGAAATCGATCAAGATTCTTATCTGGTTTTCGAGTATGCAAGGAATGGGTCCCTGTGGGATTGGATTCAGAA
CAAATTGGCCATCAAGAATCAATTCATCGAGTCTTGTTACTGTTTCTTGGCATGGAAACAGAGGATCAAGATATGTCACG
ATGTCGCCATCGCGTTAAAGTATATGCATCGGATCAACTACGTCCACGGCAACATCAAGAGCAGAAACATCTTCTTGAAC
GAAGATCTCAGAGGTAAAGTCGGAAACTTTGGGATGTCAAAGTGCGTAACCAATGAATTAGCCACAGAAGAGAACCTTAT
AGAGAGTTCACTGTCTCCAGCTTCTGACATATTTGCTTACGGGATAATCGTAATGGAGGTTTTGTCTGGACAAACCCCAG
ATATGTTGCTTGGATTGCAAGAAGTAGAGACAACATCCCTTGGGACACAAGAAACTTTTGTTTCCGAATGGAGTAGATTA
AGAAGGCTTCTCGGGGACAAGGAAAAGCTGAGGGAAGTGATGGACAGCACATTGGGAGAGAGCTATTCGGTTGATTCTGC
GTTTGAAATCGCAAGTATTGCAAGAGATTGTACTGCAGAAGAAGCCGAGTCAAGGCCGAGCGCGGTTGAGATTGCAGAGA
GGGTTTCAAGATTGGTGGATGACGATGAAGATGAAGAAGATGAGGCAGTAATAGATAGAGAGAGTACCTTAATTTCAGAG
AGTTCATACAAGCCTTTGGTAAAGAAGAGTAGTATAATAGATTAA