Details for Arabidopsis Locus AT3G01670

Position : Chr3 ( 5`- 247234 .. 250470 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01670

Protein [Map View]
MAQRFQLNSQTLPTADPLKRVSLIPRSAEQRLADNAGERRPLAPRSHEDNPFGGHTDDHHVAAPADHNKVMDHNSENLGS
IVPKTAHYPHPSEEILDANIRHSMVPKSLGPNSLGGRFGPGKKQAFHRNGRPMFSLSDDRVMADRVLKTHSPDMIFFDVT
SLLSVVNDIFKSHVPSIDSSAPKPSLVFKDYADHTSFETFADLIDQISCEIDCKCLHGGESHGMMTSGLHLDSRNTTTFS
VLSLVSKYRWDAKLVLVLSALAVKYGVFLLLAETHATNQLTKSLALIKQLPSIFSRQNALHQRLDKTRILMQDMVDLTTT
IIDIYQLPPNHITAAFTDHIPTAVYWIVRCVLICVSHISGASGFKQDQIMSFMEVSEIHENSERLRKINAYLLEQFKKSK
MTIEEGIIEEEYQELIQTFTTIIHVDVVPPLLRLLRPIDFLYHGAGVSKRRVGINVLTQKHVLLLISDLENIEKELYILE
SLYTEAWQQSFEILWVPVQDFWTEADDAKFEALHMNMRWYVLGEPRKLRRAAIRFVREWWGFKNRPILVALDPKGQVMST
NAFPMVWIWQPFAHPFTTARERDLWSEQEWNLEFLIDGTDPHSLNQLVDGKYICLYGGEDMQWIKNFTSLWRNVAKAANI
QLEMVYVGKRNPKNGIQPIINTIREENLSHTLPDLFQIWFFWTRVESMWESKQRMLKAHGIKGREGFKEEEKDLVLQEVV
AMLGYGGEGDGWGLVSKASDMMVRAKGNLFSRGLAEFNEWEVNIPTKGFLTALNDHLLMRLPPHHCTRFMLPETAGIIPN
EVECTECRRTMEKYYLYQCCLE*

DNA
ATGGCCCAACGCTTTCAATTGAACTCACAAACCCTCCCAACGGCCGACCCTCTCAAAAGGGTCTCCCTTATTCCAAGATC
CGCCGAGCAGAGGCTGGCTGATAACGCAGGCGAGAGGCGTCCTTTAGCACCGAGATCTCACGAAGACAACCCCTTTGGGG
GTCATACTGATGATCACCATGTTGCTGCTCCTGCGGACCATAATAAGGTGATGGATCATAATAGCGAGAATCTCGGTTCC
ATTGTCCCTAAGACTGCACATTACCCTCATCCATCTGAGGAAATCCTTGATGCTAATATCCGACATTCGATGGTTCCGAA
ATCATTGGGTCCCAATTCGCTCGGTGGAAGATTTGGTCCGGGAAAGAAACAAGCTTTCCATAGAAATGGCAGACCCATGT
TTTCACTTTCTGATGACCGAGTCATGGCTGATAGAGTCTTGAAGACTCACAGTCCAGACATGATCTTCTTTGATGTCACA
TCACTTCTCTCCGTTGTTAATGACATCTTCAAGTCTCATGTCCCATCCATTGACTCCTCTGCTCCTAAGCCATCACTCGT
CTTCAAGGACTACGCTGATCATACCTCCTTTGAAACTTTTGCGGATCTCATTGATCAAATCTCTTGCGAGATCGACTGCA
AGTGTCTCCATGGCGGTGAGTCTCACGGTATGATGACATCAGGGCTTCATTTGGATAGTCGCAACACGACGACGTTCTCT
GTTCTGTCTTTGGTCTCCAAATACCGTTGGGATGCTAAGCTAGTCCTTGTCCTATCTGCTTTGGCCGTGAAATACGGCGT
TTTTCTCCTCCTCGCGGAGACACACGCAACAAATCAGCTCACAAAATCTCTGGCTCTCATCAAACAGCTCCCTAGCATCT
TCTCCCGGCAGAACGCTCTACACCAGCGTCTCGACAAGACCCGAATTCTGATGCAAGACATGGTTGATCTCACCACTACC
ATCATCGATATCTATCAACTCCCGCCAAACCACATCACAGCCGCGTTTACCGACCATATCCCCACTGCGGTTTACTGGAT
TGTTCGCTGTGTTTTGATATGTGTTTCTCACATCAGTGGCGCCAGTGGTTTCAAGCAGGATCAAATCATGTCGTTTATGG
AAGTTTCGGAGATACATGAGAATAGCGAAAGGCTTAGGAAGATCAATGCTTACTTGTTAGAACAATTCAAGAAGAGTAAA
ATGACCATCGAGGAAGGTATAATCGAAGAAGAGTATCAAGAACTCATCCAGACGTTCACTACTATCATTCACGTCGACGT
TGTTCCTCCTCTACTTCGTCTTCTCAGACCCATTGATTTTCTTTACCACGGAGCTGGTGTTTCAAAGAGACGCGTCGGGA
TCAACGTGCTCACCCAAAAGCACGTTCTGCTTCTGATATCAGACCTAGAAAACATCGAAAAAGAGCTCTACATCCTGGAA
TCGCTCTACACAGAAGCATGGCAGCAGTCATTCGAGATTCTTTGGGTTCCAGTTCAAGATTTCTGGACAGAAGCTGACGA
TGCCAAGTTCGAGGCCCTTCACATGAACATGAGGTGGTACGTTCTTGGAGAGCCTCGGAAATTAAGACGAGCCGCGATAA
GGTTTGTGAGGGAATGGTGGGGTTTCAAGAACAGGCCTATACTCGTTGCACTTGATCCCAAAGGTCAAGTTATGTCAACC
AACGCCTTTCCTATGGTCTGGATCTGGCAACCCTTTGCTCACCCTTTTACCACCGCAAGGGAACGTGATCTATGGAGCGA
ACAGGAGTGGAATCTTGAGTTCTTGATTGATGGCACTGATCCTCATTCCTTAAACCAGCTTGTTGATGGAAAATACATAT
GTCTCTACGGAGGAGAAGATATGCAATGGATCAAAAACTTCACGAGTCTCTGGCGTAATGTAGCGAAGGCCGCAAACATT
CAACTTGAGATGGTTTATGTCGGGAAAAGAAACCCTAAGAATGGAATCCAGCCGATAATCAACACAATCCGGGAGGAAAA
TCTCAGCCATACTTTGCCGGACTTGTTCCAGATCTGGTTTTTCTGGACCAGGGTCGAGAGCATGTGGGAATCGAAGCAGA
GGATGCTGAAAGCCCACGGAATCAAGGGGAGAGAAGGGTTTAAAGAAGAGGAAAAGGACCTTGTTCTGCAAGAAGTGGTT
GCTATGTTAGGTTATGGAGGAGAAGGAGATGGATGGGGACTGGTGAGTAAAGCATCGGACATGATGGTTCGAGCCAAAGG
GAACTTGTTTTCTAGGGGTTTGGCTGAATTTAACGAATGGGAAGTCAACATCCCCACAAAGGGTTTTCTTACAGCGCTCA
ATGATCATCTCTTAATGCGTCTCCCACCACATCACTGCACAAGGTTCATGCTTCCTGAGACTGCTGGAATTATACCTAAT
GAGGTTGAGTGCACCGAGTGCCGTAGGACTATGGAAAAGTATTACTTGTACCAATGCTGCCTTGAGTAA