Details for Arabidopsis Locus AT3G01650

Position : Chr3 ( 5`- 242011 .. 245268 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01650

Protein [Map View]
MGGGNSKEESSSPSSSSWASHQSYPQYGPDSYNYPPPPTYAPAPSPAPAPAPVPAPSPASSYGPQYSQEGYASQPNNPPP
PTYAPAPSPASSYGHQYSQEGYASAASQPNYPPPPSQSQVADRKKFDRRYSKISDNYSSLLQVSEALGRAGLESSNLIVG
IDFTKSNEWTGAKSFNRKSLHHLSNTPNPYEQAITIIGRTLAAFDEDNLIPCYGFGDASTHDQDVFSFYPEGRFCNGFEE
VLARYREIVPQLKLAGPTSFAPIIEMAMTVVEQSSGQYHVLVIIADGQVTRSVDTEHGRLSPQEQKTVDAIVKASTLPLS
IVLVGVGDGPWDMMQEFDDNIPARAFDNFQFVNFTEIMSKNKDQSRKETEFALSALMEIPPQYKATIELNLLGVRNGNIP
QRIPLPPPVQSGSSFSSSRIPNFEPSVPPYPFESKQMSSADDIQLCPICLSNPKNMAFGCGHQTCCECGPDLKVCPICRA
PIQTRIKLY*

DNA
ATGGGAGGAGGGAATTCCAAAGAAGAGTCGTCATCACCATCTTCATCATCATGGGCTTCTCATCAAAGTTATCCTCAATA
TGGACCTGATAGCTACAACTATCCTCCTCCACCCACTTATGCTCCCGCTCCATCTCCTGCTCCTGCTCCTGCTCCGGTGC
CTGCTCCATCTCCGGCTTCCAGTTATGGCCCTCAGTATAGTCAAGAGGGTTATGCATCACAGCCTAATAATCCTCCACCA
CCCACTTATGCTCCCGCTCCATCTCCGGCTTCCAGTTATGGCCATCAGTATAGTCAAGAGGGCTATGCATCAGCAGCATC
ACAGCCTAATTATCCTCCACCTCCTTCACAGAGTCAAGTTGCTGACAGGAAGAAATTTGATCGGAGGTATTCCAAAATAT
CGGATAACTACTCTTCTTTACTGCAGGTGTCCGAGGCTCTAGGCCGTGCAGGTCTTGAATCTTCTAATCTAATCGTTGGT
ATTGATTTCACCAAGAGCAATGAATGGACAGGGGCCAAGTCCTTCAATAGGAAAAGCTTGCATCACTTGAGCAATACCCC
GAATCCATACGAGCAAGCAATTACTATCATTGGAAGAACCTTAGCCGCCTTTGACGAGGATAACTTAATTCCTTGTTATG
GTTTTGGAGACGCATCAACTCATGATCAAGACGTGTTTAGTTTCTATCCAGAGGGAAGATTCTGTAATGGATTTGAGGAA
GTATTGGCTCGTTATAGAGAAATTGTACCTCAGCTTAAGCTCGCAGGACCAACTTCTTTTGCCCCGATCATTGAAATGGC
AATGACAGTGGTTGAGCAGAGTAGTGGCCAATATCATGTGTTAGTGATTATAGCTGATGGCCAGGTCACAAGAAGTGTCG
ATACCGAACACGGGCGGCTAAGTCCGCAAGAACAGAAGACAGTAGATGCAATTGTGAAAGCAAGTACCCTTCCTTTGTCA
ATAGTCTTAGTTGGGGTCGGGGATGGACCATGGGACATGATGCAGGAATTTGATGATAACATACCTGCCCGAGCTTTCGA
TAACTTCCAGTTTGTGAACTTCACAGAGATCATGTCAAAGAACAAAGACCAGTCTCGGAAGGAGACAGAGTTTGCGCTGT
CTGCTCTCATGGAGATCCCTCCACAGTACAAAGCAACGATAGAGCTTAACCTTTTAGGGGTAAGAAATGGAAATATCCCA
CAGAGAATCCCACTTCCGCCACCGGTGCAGAGTGGATCATCATTCTCTAGTTCCCGGATACCGAATTTTGAACCGAGTGT
ACCTCCTTATCCATTTGAGAGCAAGCAAATGAGTAGTGCAGACGATATTCAGCTATGTCCGATATGTCTGAGCAACCCGA
AAAACATGGCGTTTGGTTGTGGCCATCAGACTTGTTGTGAATGCGGACCAGATCTTAAAGTGTGTCCTATTTGTCGTGCG
CCGATCCAGACCAGAATCAAGCTTTACTAA