Details for Arabidopsis Locus AT3G01520

Position : Chr3 ( 5`- 208439 .. 210137 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01520

Protein [Map View]
MGSEPTKVMVAVNASTIKDYPNPSISCKRAFEWTLEKIVRSNTSDFKILLLHVQVVDEDGFDDVDSIYASPEDFRDMRQS
NKAKGLHLLEFFVNKCHEIGVGCEAWIKTGDPKDVICQEVKRVRPDFLVVGSRGLGRFQKVFVGTVSAFCVKHAECPVMT
IKRNADETPSDPADD*

DNA
ATGGGGAGCGAGCCAACAAAAGTGATGGTGGCGGTGAACGCTTCGACGATCAAAGACTATCCTAACCCTTCGATTAGCTG
CAAAAGAGCATTCGAATGGACTCTGGAGAAGATCGTAAGGTCCAACACTTCCGATTTCAAGATTCTCTTGCTCCACGTAC
AAGTCGTCGACGAAGACGGTTTTGATGACGTGGATAGCATTTATGCTTCCCCTGAGGATTTCCGAGACATGAGACAATCT
AACAAGGCAAAAGGTCTTCACCTTCTCGAGTTTTTCGTTAATAAATGTCATGAGATTGGGGTTGGTTGCGAGGCCTGGAT
TAAGACAGGTGATCCCAAGGATGTCATATGCCAAGAAGTGAAGCGAGTTCGACCAGATTTTCTGGTCGTGGGAAGTCGTG
GACTTGGCCGGTTTCAAAAGGTCTTTGTGGGGACTGTGAGTGCGTTCTGTGTGAAACATGCGGAGTGTCCAGTTATGACG
ATCAAACGCAATGCCGATGAAACTCCCAGTGATCCAGCTGATGACTAA