Details for Arabidopsis Locus AT3G01516

Position : Chr3 ( 5`- 207336 .. 208086 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01516

Protein [Map View]
MEEENQKSHRVSRKDQSGSHWSQGADEEPRARCSGKRCRSWAAAAIADCVALCCCPCAVVNIFTLAFVKVPWMIGRKCIG
RGGPSKKRMKKINREDRFHHHHHHRRSAEMVSGGCCGGGDGDGEFDDHRFVVERDGSLTKEEAKTASLKEEEETRISARV
EAERVWLELYQIGHLGFGRVSFTGIHQ*

DNA
ATGGAGGAGGAAAACCAAAAGTCGCATCGAGTTTCACGTAAAGACCAGAGTGGATCCCACTGGAGTCAAGGAGCCGATGA
AGAGCCGAGAGCCAGATGCTCCGGGAAAAGGTGCCGGTCTTGGGCGGCGGCGGCGATCGCTGACTGCGTGGCGCTCTGCT
GTTGTCCCTGCGCCGTGGTGAACATCTTCACTCTCGCCTTTGTTAAGGTCCCGTGGATGATAGGCCGGAAATGTATCGGC
CGTGGTGGCCCGAGTAAGAAGCGGATGAAGAAAATCAACCGTGAGGATCGGTTTCATCACCATCACCACCACAGGAGGTC
GGCCGAGATGGTGAGTGGTGGATGTTGCGGTGGCGGAGATGGAGATGGAGAGTTCGATGACCATCGGTTTGTGGTGGAAA
GAGACGGGAGTTTGACCAAAGAGGAAGCCAAAACGGCGTCGTTAAAAGAAGAGGAAGAGACGAGAATAAGTGCGAGAGTG
GAAGCAGAGAGAGTTTGGTTAGAGTTGTATCAGATTGGGCATCTTGGCTTTGGTAGAGTCTCCTTCACTGGCATTCATCA
ATGA