Details for Arabidopsis Locus AT3G01513

Position : Chr3 ( 5`- 201920 .. 202740 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01513

Protein [Map View]
MQDFSSTVSYSPSFSYYASGEFAAAAVKVSRENESYNIRDHESVKVNSVNDEDVDFEFETSPLHEETFVHFPTFKTNVVS
TTNKTDKEAAAEKISERFPGNCLWSPLRSPAASKHSESSTSTPKRCRLKKFLTRSHSDGGVLPSSASKRCYTFKDLKRRS
HSDGGGDTSKRSSPTVKVKNKTVSYKVGEGDKRRKSYLPYRQDLIGVFAVIRGLRR*

DNA
ATGCAGGATTTTTCTTCAACGGTGTCGTATAGCCCAAGCTTCAGTTACTACGCTTCCGGTGAATTCGCCGCCGCTGCAGT
TAAAGTTTCCCGCGAAAACGAAAGCTACAATATCAGAGATCATGAGTCCGTTAAAGTCAACTCCGTCAATGACGAAGACG
TTGACTTCGAGTTTGAAACGTCGCCGTTACATGAAGAAACCTTCGTCCACTTCCCGACGTTCAAAACCAACGTCGTTTCC
ACTACTAACAAGACAGACAAAGAAGCCGCCGCTGAAAAAATATCGGAGCGTTTCCCCGGAAATTGTCTGTGGAGTCCACT
CAGATCTCCGGCTGCTTCGAAACACTCAGAATCATCTACTAGCACACCGAAACGGTGCCGTTTGAAGAAATTTCTAACGA
GAAGTCATAGCGACGGTGGTGTTTTGCCCTCAAGTGCATCAAAACGGTGCTATACTTTTAAGGATCTTAAGCGGAGGAGC
CACAGCGACGGCGGCGGCGACACCAGTAAGAGGAGCTCGCCGACCGTGAAAGTTAAGAACAAAACGGTGTCGTATAAGGT
CGGGGAAGGTGACAAGAGAAGAAAATCTTATTTGCCTTACCGGCAAGATTTGATCGGAGTTTTCGCCGTGATTAGAGGGT
TACGTCGTTAA