Details for Arabidopsis Locus AT3G01470

Position : Chr3 ( 5`- 182396 .. 184403 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01470

Protein [Map View]
MESNSFFFDPSASHGNSMFFLGNLNPVVQGGGARSMMNMEETSKRRPFFSSPEDLYDDDFYDDQLPEKKRRLTTEQVHLL
EKSFETENKLEPERKTQLAKKLGLQPRQVAVWFQNRRARWKTKQLERDYDLLKSTYDQLLSNYDSIVMDNDKLRSEVTSL
TEKLQGKQETANEPPGQVPEPNQLDPVYINAAAIKTEDRLSSGSVGSAVLDDDAPQLLDSCDSYFPSIVPIQDNSNASDH
DNDRSCFADVFVPTTSPSHDHHGESLAFWGWP*

DNA
ATGGAATCCAATTCGTTTTTCTTCGATCCATCTGCTTCACACGGCAACAGCATGTTCTTCCTTGGGAATCTCAATCCCGT
CGTCCAAGGAGGAGGAGCAAGATCGATGATGAACATGGAGGAAACTTCGAAGCGAAGGCCCTTCTTTAGCTCCCCTGAGG
ATCTCTACGACGATGACTTTTACGACGACCAGTTGCCTGAAAAGAAGCGTCGCCTCACTACCGAACAAGTGCATCTGCTG
GAGAAAAGCTTCGAGACAGAGAACAAGCTAGAGCCTGAACGCAAGACTCAGCTTGCCAAGAAGCTTGGTCTACAGCCAAG
GCAAGTGGCTGTCTGGTTTCAGAATCGCCGAGCTCGTTGGAAAACAAAACAGCTTGAGAGAGACTACGATCTTCTCAAGT
CCACTTACGACCAACTTCTTTCTAACTACGACTCCATCGTCATGGACAACGATAAGCTCAGATCCGAGGTTACTTCCCTG
ACCGAAAAGCTTCAGGGCAAACAAGAGACAGCTAATGAACCACCTGGTCAAGTGCCCGAACCAAACCAACTTGATCCGGT
TTACATTAATGCGGCAGCAATCAAAACCGAGGACCGGTTAAGTTCAGGGAGCGTTGGGAGCGCGGTACTAGACGACGACG
CACCTCAACTACTAGACAGCTGTGACTCTTACTTCCCAAGCATCGTACCCATCCAAGACAACAGCAACGCCAGTGATCAT
GACAATGACCGGAGCTGTTTCGCCGACGTCTTTGTGCCCACCACTTCACCGTCGCACGATCATCACGGTGAATCATTGGC
TTTCTGGGGATGGCCTTAG