Details for Arabidopsis Locus AT3G01460

Position : Chr3 ( 5`- 173316 .. 182454 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01460

Protein [Map View]
MEPTDSTNEQLGDTKTAAVKEESRSFLGIDLNEIPTGATLGGGCTAGQDDDGEYEPVEVVRSIHDNPDPAPGAPAEVPEP
DRDASCGACGRPESIELVVVCDACERGFHMSCVNDGVEAAPSADWMCSDCRTGGERSKLWPLGVKSKLILDMNASPPSDA
EGYGAEETSDSRKHMLASSSCIGNSFDYAMMHSSFSSLGRGHASLEASGLMSRNTKMSMDALGSHNLGFGFPLNLNNSSL
PMRFPSLDPSELFLQNLRHFISERHGVLEDGWRVEFRQPLNGYQLCAVYCAPNGKTFSSIQEVACYLGLAINGNYSCMDA
EIRNENSLLQERLHTPKRRKTSRWPNNGFPEQKGSSVSAQLRRFPFNGQTMSPFAVKSGTHFQAGGSLSSGNNGCGCEEA
KNGCPMQFEDFFVLSLGRIDIRQSYHNVNVIYPIGYKSCWHDKITGSLFTCEVSDGNSGPIFKVTRSPCSKSFIPAGSTV
FSCPKIDEMVEQNSDKLSNRRDSTQERDDDASVEILLSEHCPPLGDDILSCLREKSFSKTVNSLRSEVDSSRVDFDKNLS
YDQDHGVEIGDIVVEEDSLSDAWKKVSQKLVDACSIVLKQKGTLNFLCKHVDRETSEINWDTMNEKDNVILSLSKFCCSL
APCSVTCGEKDKSEFAAVVDALSRWLDQNRFGLDADFVQEMIEHMPGAESCTNYRTLKSRSSSSVPITVAEGALVVKPKG
GENVKDEVFGEISRKAKKPKLNGGHGVRNLHPPPGRPMCLRLPPGLVGDFLQVSEVFWRFHEILGFEEAFSPENLEQELI
NPVFDGLFLDKPGKDDKRSEINFTDKDSTATKLFSLFDESRQPFPAKNTSASELKEKKAGDSSDFKISDSSRGSCVGALL
TRAHISLLQVLICELQSKVAAFVDPNFDSGESRSRRGRKKDDSTLSAKRNKLHMLPVNEFTWPELARRYILSLLSMDGNL
ESAEIAARESGKVFRCLQGDGGLLCGSLTGVAGMEADSMLLAEAIKKISGSLTSENDVLSVEDDDSDGLDATETNTCSGD
IPEWAQVLEPVKKLPTNVGTRIRKCVYEALERNPPEWAKKILEHSISKEIYKGNASGPTKKAVLSLLADIRGGDLVQRSI
KGTKKRTYISVSDVIMKKCRAVLRGVAAADEDKVLCTLLGRKLLNSSDNDDDGLLGSPAMVSRPLDFRTIDLRLAAGAYD
GSTEAFLEDVLELWSSIRVMYADQPDCVDLVATLSEKFKSLYEAEVVPLVQKLKDYRKLECLSAEMKKEIKDIVVSVNKL
PKAPWDEGVCKVCGVDKDDDSVLLCDTCDAEYHTYCLNPPLIRIPDGNWYCPSCVIAKRMAQEALESYKLVRRRKGRKYQ
GELTRASMELTAHLADVMEEKDYWEFSAEERILLLKLLCDELLSSSLVHQHLEQCAEAIIEMQQKLRSLSSEWKNAKMRQ
EFLTAKLAKVEPSILKEVGEPHNSSYFADQMGCDPQPQEGVGDGVTRDDETSSTAYLNKNQGKSPLETDTQPGESHVNFG
ESKISSPETISSPGRHELPIADTSPLVTDNLPEKDTSETLLKSVGRNHETHSPNSNAVELPTAHDASSQASQELQACQQD
LSATSNEIQNLQQSIRSIESQLLKQSIRRDFLGTDASGRLYWGCCFPDENPRILVDGSISLQKPVQADLIGSKVPSPFLH
TVDHGRLRLSPWTYYETETEISELVQWLHDDDLKERDLRESILWWKRLRYGDVQKEKKQAQNLSAPVFATGLETKAAMSM
EKRYGPCIKLEMETLKKRGKKTKVAEREKLCRCECLESILPSMIHCLICHKTFASDDEFEDHTESKCIPYSLATEEGKDI
SDSSKAKESLKSDYLNVKSSAGKDVAEISNVSELDSGLIRYQEEESISPYHFEEICSKFVTKDCNRDLVKEIGLISSNGI
PTFLPSSSTHLNDSVLISAKSNKPDGGDSGDQVIFAGPETNVEGLNSESNMSFDRSVTDSHGGPLDKPSGLGFGFSEQKN
KKSSGSGLKSCCVVPQAALKRVTGKALPGFRFLKTNLLDMDVALPEEALRPSKSHPNRRRAWRVFVKSSQSIYELVQATI
VVEDMIKTEYLKNEWWYWSSLSAAAKISTLSALSVRIFSLDAAIIYDKPITPSNPIDETKPIISLPDQKSQPVSDSQERS
SRVRRSGKKRKEPEGS*

DNA
ATGGAACCCACTGATTCTACTAACGAGCAACTCGGAGACACTAAGACCGCCGCTGTCAAGGAAGAGAGTCGCTCCTTTCT
CGGCATCGATCTCAACGAAATCCCTACCGGCGCTACTCTCGGCGGTGGTTGCACCGCTGGTCAGGATGACGACGGCGAAT
ATGAACCTGTTGAAGTTGTTAGGTCAATTCACGATAACCCGGACCCAGCCCCTGGAGCCCCTGCCGAGGTTCCTGAACCG
GATCGGGATGCTTCGTGCGGCGCGTGTGGAAGACCTGAGTCTATAGAGCTCGTTGTAGTCTGCGATGCCTGTGAGCGAGG
CTTTCATATGTCTTGTGTCAACGATGGAGTTGAGGCGGCTCCTTCCGCCGATTGGATGTGCAGCGACTGTCGTACTGGCG
GCGAGAGGAGCAAACTGTGGCCGTTGGGGGTTAAGTCCAAGCTCATTCTGGACATGAACGCCTCGCCGCCCAGTGATGCT
GAGGGATACGGAGCTGAGGAGACGTCTGATTCGAGAAAGCATATGCTCGCCAGCAGCTCTTGCATTGGAAACTCTTTTGA
TTATGCAATGATGCATTCAAGCTTCTCAAGTCTCGGTAGAGGACATGCTAGTCTCGAAGCTTCAGGGTTAATGTCTCGTA
ATACTAAAATGAGTATGGATGCATTGGGTTCACATAATCTAGGTTTTGGATTCCCATTAAACTTGAACAATAGTAGTTTG
CCCATGAGATTTCCATCCTTGGATCCAAGTGAGTTGTTTCTGCAAAATCTCAGGCATTTCATATCTGAAAGGCATGGAGT
ATTGGAAGATGGCTGGCGTGTCGAATTCAGACAACCTTTAAATGGTTATCAGTTATGTGCAGTGTATTGTGCTCCGAATG
GAAAAACATTTAGTTCAATACAAGAAGTTGCTTGTTATCTGGGCTTGGCAATTAATGGTAACTACAGCTGTATGGATGCT
GAAATCAGGAATGAGAATTCTCTTCTTCAAGAAAGATTGCATACGCCCAAGAGAAGAAAGACATCAAGATGGCCAAACAA
TGGTTTCCCTGAGCAAAAGGGTAGTTCAGTGAGTGCTCAACTCAGGCGTTTTCCATTCAATGGTCAGACCATGTCTCCTT
TCGCCGTTAAATCTGGTACTCATTTTCAGGCTGGTGGTTCTCTTAGCTCTGGAAATAATGGATGCGGTTGTGAGGAAGCT
AAGAATGGATGTCCGATGCAGTTTGAAGATTTCTTTGTTCTGTCGCTTGGACGAATTGACATAAGACAGTCTTACCATAA
TGTCAACGTGATTTATCCAATAGGATATAAGTCCTGCTGGCATGACAAGATCACGGGGTCACTATTTACATGTGAAGTAT
CTGATGGCAATTCTGGTCCCATTTTCAAGGTTACACGGTCACCATGCTCGAAATCATTTATTCCAGCTGGATCAACTGTC
TTCTCCTGCCCAAAGATTGATGAAATGGTGGAACAGAACAGTGACAAACTTAGTAATCGTAGAGATAGTACTCAAGAGCG
TGATGATGACGCTAGTGTTGAGATCCTTCTTTCGGAACACTGCCCACCTCTTGGAGATGATATATTGTCTTGTTTACGTG
AGAAGAGTTTCTCCAAGACAGTCAATTCCCTGCGCTCAGAGGTTGATTCTTCTCGAGTAGATTTTGATAAAAATTTATCC
TATGATCAGGACCATGGGGTTGAAATTGGTGACATTGTTGTGGAAGAAGATTCATTGTCTGATGCATGGAAAAAAGTGTC
TCAAAAACTTGTTGATGCATGTTCAATTGTACTGAAGCAGAAGGGTACCCTGAATTTCCTATGTAAGCATGTTGACAGAG
AAACAAGTGAAATCAACTGGGATACCATGAATGAGAAAGACAATGTAATTTTATCGTTGTCAAAATTTTGCTGTTCGTTG
GCTCCTTGCAGTGTCACGTGTGGTGAAAAGGATAAAAGCGAATTTGCAGCAGTAGTTGATGCTTTGTCAAGGTGGCTCGA
TCAAAACAGATTTGGACTTGATGCAGATTTTGTACAGGAAATGATTGAACATATGCCTGGTGCCGAATCATGTACGAATT
ATAGGACTCTGAAGAGTAGAAGTTCTTCTTCTGTTCCTATAACTGTAGCGGAAGGAGCGCTAGTGGTCAAACCAAAAGGT
GGGGAAAATGTCAAGGACGAAGTTTTCGGTGAGATTTCTCGGAAAGCCAAGAAGCCTAAACTAAATGGTGGTCATGGTGT
CAGAAATCTACACCCTCCTCCTGGGAGGCCAATGTGTTTGAGGCTCCCTCCTGGGCTTGTTGGTGACTTCCTTCAGGTAT
CTGAAGTGTTCTGGCGTTTCCATGAAATTTTGGGTTTTGAAGAGGCTTTCTCACCTGAAAACCTTGAACAGGAGCTTATC
AATCCAGTGTTTGATGGTTTGTTTCTTGATAAACCTGGGAAAGATGATAAGAGAAGTGAGATTAACTTTACTGATAAGGA
TTCTACAGCTACTAAACTTTTTTCTTTGTTCGATGAATCTCGCCAACCTTTTCCTGCAAAAAATACCTCTGCTTCTGAAC
TAAAGGAGAAAAAGGCAGGGGATTCTTCTGATTTTAAGATTTCAGATTCCTCTCGTGGGTCGTGTGTGGGTGCACTTCTA
ACAAGGGCTCACATTTCGCTTCTGCAAGTGCTAATATGTGAGCTGCAATCCAAGGTAGCTGCATTTGTTGATCCAAACTT
TGATTCTGGCGAATCGAGATCCAGACGAGGACGAAAAAAGGATGACAGTACACTTTCTGCTAAAAGAAATAAGCTGCATA
TGCTTCCTGTTAATGAGTTCACTTGGCCTGAATTGGCCCGTAGGTACATCTTGTCTCTTTTATCCATGGATGGGAACCTC
GAATCAGCAGAGATTGCTGCACGTGAAAGTGGTAAGGTATTCCGTTGCTTACAAGGGGATGGTGGTTTGCTTTGCGGCTC
GCTTACAGGAGTGGCTGGGATGGAAGCAGATTCAATGTTACTTGCAGAGGCTATTAAGAAAATATCTGGTTCGTTGACAA
GCGAAAATGATGTTCTTTCTGTGGAAGATGATGATTCCGATGGCCTTGATGCTACTGAGACAAACACTTGCAGTGGTGAT
ATTCCAGAGTGGGCTCAGGTTTTGGAACCTGTGAAAAAGCTTCCAACAAATGTTGGGACTAGAATCAGAAAGTGTGTCTA
TGAAGCTTTAGAGAGAAATCCACCAGAGTGGGCAAAGAAGATATTGGAGCATTCTATCAGTAAAGAAATATATAAAGGCA
ATGCATCAGGACCAACAAAGAAAGCTGTCCTCTCATTGCTAGCGGATATTCGAGGTGGAGACTTGGTGCAGAGGTCTATT
AAAGGAACCAAAAAGCGGACATATATAAGTGTATCTGATGTCATTATGAAGAAATGCCGTGCTGTATTGCGTGGTGTTGC
AGCTGCAGACGAGGATAAAGTCCTTTGCACTTTACTGGGAAGAAAGTTACTGAATTCCAGTGATAATGATGATGACGGGC
TCCTGGGATCACCTGCAATGGTTTCGCGTCCCTTAGACTTCAGAACTATTGATTTGAGGTTGGCTGCTGGTGCGTATGAC
GGATCAACTGAAGCTTTTCTTGAAGATGTTCTTGAGCTGTGGAGTAGTATACGTGTTATGTATGCAGATCAGCCCGATTG
TGTGGACCTGGTTGCAACATTGTCTGAAAAATTCAAGTCGTTATACGAGGCTGAGGTTGTACCACTTGTTCAGAAACTTA
AGGACTACAGGAAATTGGAATGCCTAAGTGCAGAGATGAAGAAGGAAATTAAGGACATAGTTGTTTCAGTAAATAAGCTT
CCCAAGGCCCCGTGGGATGAGGGGGTATGTAAAGTATGTGGCGTTGACAAAGATGATGACAGTGTTCTCTTGTGTGATAC
ATGCGATGCTGAGTATCACACATATTGTTTAAATCCACCTCTTATTAGAATTCCTGATGGAAATTGGTATTGTCCATCTT
GTGTCATTGCCAAGCGCATGGCTCAAGAGGCTTTGGAATCTTACAAACTAGTTAGGCGGCGGAAAGGTAGAAAGTATCAG
GGGGAACTCACCCGAGCTTCTATGGAACTGACTGCTCACCTGGCAGATGTGATGGAAGAAAAGGACTACTGGGAGTTTAG
TGCTGAGGAGAGAATCTTGCTGCTTAAGCTTCTATGCGATGAACTGCTTAGTTCATCTCTTGTCCATCAACACCTTGAGC
AGTGTGCCGAAGCAATAATTGAAATGCAGCAGAAGTTACGCTCTCTTTCCTCAGAATGGAAAAACGCAAAAATGCGGCAA
GAATTCCTGACGGCTAAACTGGCAAAGGTTGAACCGAGTATTCTGAAGGAAGTGGGCGAACCACATAATTCAAGCTACTT
TGCAGACCAAATGGGATGTGATCCACAACCACAGGAGGGCGTTGGAGACGGAGTTACTCGTGATGATGAGACTTCCTCTA
CTGCATATCTTAACAAGAATCAAGGTAAATCTCCACTTGAAACCGATACTCAACCCGGAGAGTCGCATGTTAATTTCGGT
GAGAGCAAAATTTCCTCCCCGGAAACAATATCATCCCCTGGGAGGCATGAGCTACCTATAGCAGATACCTCTCCTCTTGT
AACAGATAATCTGCCTGAAAAAGATACCTCGGAGACCTTGCTTAAGTCAGTTGGAAGGAATCATGAAACACATTCACCAA
ATTCCAATGCAGTAGAATTGCCGACAGCTCATGATGCATCTTCTCAGGCTTCCCAAGAGTTGCAGGCTTGTCAGCAGGAT
TTGAGTGCCACTAGTAATGAAATTCAGAATCTTCAGCAATCAATTAGAAGCATAGAATCACAGCTTCTAAAGCAATCTAT
ACGGAGAGATTTTCTGGGAACCGATGCTAGTGGTCGGTTATATTGGGGTTGCTGCTTCCCAGATGAAAATCCTCGTATAT
TGGTTGATGGAAGCATATCTTTGCAGAAACCTGTTCAAGCCGATTTGATAGGTTCAAAAGTCCCCTCTCCGTTTCTCCAT
ACCGTTGACCATGGAAGACTAAGGCTTTCACCCTGGACGTATTATGAAACTGAAACCGAGATCAGTGAGCTTGTCCAATG
GCTTCATGATGATGATCTGAAAGAAAGAGACCTGAGAGAGTCTATTTTGTGGTGGAAAAGGTTACGATATGGAGACGTTC
AAAAGGAAAAGAAACAAGCTCAGAATTTATCTGCTCCGGTATTTGCTACGGGTCTTGAGACCAAGGCTGCCATGTCAATG
GAGAAGAGATATGGTCCATGCATCAAACTGGAGATGGAAACCTTAAAAAAACGGGGGAAGAAGACAAAGGTTGCAGAGCG
AGAGAAATTGTGTAGATGCGAATGCTTGGAATCCATTTTGCCATCTATGATTCACTGCCTCATATGCCATAAAACATTCG
CAAGTGATGATGAGTTTGAGGATCACACTGAGAGTAAGTGTATTCCTTATTCATTAGCAACTGAAGAAGGCAAGGACATC
TCTGATTCTTCAAAAGCCAAAGAAAGTCTGAAATCCGATTATCTTAATGTAAAGTCTAGTGCCGGCAAAGATGTAGCTGA
AATATCCAATGTTTCTGAACTTGATTCTGGGTTGATAAGATATCAAGAAGAAGAATCTATTTCCCCATACCATTTTGAGG
AGATCTGTTCCAAGTTTGTGACAAAGGATTGCAACAGAGATTTGGTTAAAGAGATCGGTCTGATCAGTTCAAATGGCATT
CCAACATTTCTTCCATCGTCATCTACTCATCTTAACGACTCCGTGCTCATCTCTGCCAAATCCAATAAGCCAGATGGTGG
TGATTCAGGGGATCAGGTCATTTTTGCTGGTCCTGAAACCAATGTTGAAGGCTTAAATTCTGAATCTAACATGTCATTCG
ATAGATCTGTCACAGACAGTCACGGGGGTCCACTGGATAAACCAAGTGGACTGGGTTTTGGCTTCTCAGAGCAAAAGAAT
AAGAAATCTTCAGGTAGTGGGTTGAAAAGCTGCTGTGTGGTTCCACAGGCTGCTTTGAAACGAGTAACTGGCAAAGCTTT
GCCGGGTTTCAGGTTCCTGAAAACCAACTTGCTTGATATGGATGTAGCACTGCCTGAAGAAGCTTTAAGACCATCGAAAT
CACATCCAAACCGTAGAAGAGCTTGGCGTGTATTTGTTAAATCGTCGCAAAGTATATACGAGTTGGTTCAGGCAACAATT
GTGGTAGAAGATATGATTAAGACAGAGTACTTGAAAAATGAATGGTGGTACTGGTCTTCTCTTTCAGCGGCTGCTAAAAT
CTCGACTCTCTCAGCGTTATCCGTCCGTATCTTCTCCCTCGACGCTGCTATCATTTATGATAAACCCATAACTCCATCAA
ATCCTATCGATGAAACAAAGCCGATCATCAGCTTACCGGACCAAAAGTCACAGCCGGTTTCGGATTCTCAAGAAAGAAGC
AGCAGAGTTAGAAGATCTGGCAAGAAAAGGAAAGAACCCGAGGGATCCTAG