Details for Arabidopsis Locus AT3G01420

Position : Chr3 ( 5`- 159466 .. 162837 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01420

Protein [Map View]
MKVITSLISSILLKFIHKDFHEIYARMSLLDRFLLLIVHGVDKMVPWHKLPVFLGLTYLEVRRHLHQQYNLLNVGQTPTG
IRFDPANYPYRTADGKFNDPFNEGVGSQNSFFGRNCPPVDQKSKLRRPDPMVVATKLLGRKKFIDTGKQFNMIAASWIQF
MIHDWIDHLEDTHQIELVAPKEVASKCPLSSFRFLKTKEVPTGFFEIKTGSQNIRTPWWDSSVIYGSNSKTLDRVRTYKD
GKLKISEETGLLLHDEDGLAISGDIRNSWAGVSALQALFIKEHNAVCDALKDEDDDLEDEDLYRYARLVTSAVVAKIHTI
DWTVQLLKTDTLLAGMRANWYGLLGKKFKDSFGHAGSSILGGVVGMKKPQNHGVPYSLTEDFTSVYRMHSLLPDQLHILD
IDDVPGTNKSLPLIQEISMRDLIGRKGEETMSHIGFTKLMVSMGHQASGALELMNYPMWLRDIVPHDPNGQARPDHVDLA
ALEIYRDRERSVPRYNEFRRSMFMIPITKWEDLTEDEEAIEVLDDVYDGDVEELDLLVGLMAEKKIKGFAISETAFYIFL
IMATRRLEADRFFTSDFNETIYTKKGLEWVNTTESLKDVIDRHYPDMTDKWMNSESAFSVWDSPPLTKNPIPLYLRIPS*

DNA
ATGAAAGTAATTACTTCCCTAATCTCTTCTATTTTGCTTAAATTCATCCACAAAGACTTCCATGAGATTTATGCAAGAAT
GTCCCTCCTCGATCGGTTTCTTCTTCTTATCGTGCATGGAGTGGATAAGATGGTTCCATGGCATAAGCTTCCAGTATTCT
TGGGGTTAACCTATCTTGAAGTACGAAGACATCTTCACCAACAATACAATCTTCTCAACGTCGGTCAAACTCCGACTGGG
ATCCGGTTTGATCCTGCTAATTATCCGTACCGGACTGCTGACGGAAAATTCAATGATCCCTTTAATGAAGGCGTCGGCAG
TCAAAATAGTTTTTTCGGGAGAAATTGTCCCCCCGTCGATCAGAAATCAAAGTTACGGAGGCCAGACCCCATGGTGGTGG
CGACAAAACTATTAGGAAGGAAAAAGTTTATCGACACGGGAAAACAATTCAACATGATTGCAGCTTCTTGGATTCAGTTC
ATGATCCATGATTGGATTGATCATCTTGAAGACACTCACCAAATCGAACTTGTCGCTCCAAAAGAAGTAGCGAGCAAGTG
TCCCTTAAGCTCCTTTAGGTTCTTAAAGACCAAGGAAGTCCCTACCGGTTTCTTCGAAATCAAGACTGGCTCGCAAAATA
TCCGTACACCTTGGTGGGATTCGAGCGTCATCTATGGAAGCAACTCGAAAACATTGGATAGAGTAAGAACTTACAAAGAC
GGGAAACTAAAGATATCGGAGGAGACGGGTCTCCTTCTCCATGACGAAGACGGTTTAGCTATCTCCGGCGACATTCGTAA
CAGTTGGGCTGGTGTCTCCGCTTTGCAAGCTCTCTTCATCAAAGAGCACAACGCCGTATGCGACGCCCTCAAGGATGAGG
ATGATGATTTGGAAGACGAAGATTTGTACCGGTACGCTAGGCTAGTGACCTCAGCCGTGGTAGCCAAGATTCACACCATA
GATTGGACAGTCCAGCTTCTCAAAACCGACACTTTACTTGCTGGGATGCGAGCAAATTGGTACGGACTACTAGGAAAGAA
GTTTAAAGATTCTTTCGGACATGCAGGCAGTTCGATCTTGGGAGGTGTCGTGGGAATGAAGAAACCGCAAAATCATGGGG
TCCCTTACTCTCTAACTGAAGATTTCACCAGCGTCTATCGAATGCATTCTCTCTTACCTGATCAACTCCATATACTTGAC
ATTGATGATGTACCAGGAACTAATAAATCACTACCGTTGATTCAAGAGATTTCTATGAGAGATTTGATTGGTCGCAAGGG
AGAAGAAACCATGTCTCACATTGGATTCACTAAGCTAATGGTCTCAATGGGTCACCAAGCAAGTGGTGCCCTTGAACTGA
TGAATTATCCGATGTGGTTAAGAGACATTGTTCCCCACGACCCCAACGGCCAAGCTCGTCCAGACCACGTCGACTTAGCT
GCTTTAGAGATCTACAGGGACAGGGAGAGGAGCGTCCCACGGTACAACGAGTTCAGGAGATCTATGTTTATGATTCCGAT
AACCAAGTGGGAAGATCTAACGGAGGATGAGGAAGCTATTGAAGTGTTGGATGACGTGTACGATGGTGATGTGGAGGAGC
TTGATCTTCTCGTGGGACTTATGGCAGAGAAGAAAATCAAAGGTTTTGCTATCAGTGAGACTGCTTTTTACATTTTCCTC
ATCATGGCCACAAGGCGATTAGAAGCGGATAGGTTTTTCACGAGTGATTTCAATGAAACGATTTACACGAAGAAGGGGCT
TGAATGGGTGAATACTACAGAGAGTCTCAAGGATGTGATTGATCGTCATTATCCTGATATGACAGACAAATGGATGAACT
CTGAAAGTGCATTTTCAGTATGGGATTCACCTCCACTTACCAAAAATCCAATCCCTCTCTATCTCCGAATTCCCTCTTAA