Details for Arabidopsis Locus AT3G01350

Position : Chr3 ( 5`- 135024 .. 137460 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01350

Protein [Map View]
MDLEQKTRGLSKSCALLIVIAGMERYAFKGVASNLVTYLTDVVKMSNSRAAKTVNTWAGFTSMLPLFSAPLADTYWDRFF
TILASSSVYFVGLVGLTWTAFAGSRSATKTISSYFLYSSLCLVSIGLGVLNPSLQAFGADQLDHDLDKNFDLSSGDQKDA
KATRKTQFFQLWYFGVCTGSLMGVTVMAYIQDTFGWVLGFAIPGIVIFLSILVFMSGCGIYVYAPGARLKKKTTTTPFEK
ILKFIKGRVVKQRSIYTLADEKDLDAMELELEERPLCKCETEDIETPSTTSKGLEDDESSKTVFSGIDNVKLVIRLFPIW
MMLLMFAVIFQLPATFFTKQGVTMKRNIGSNFKIPPATLQSTITLSIILLMPLYDKILIPITKRIKKNGTGISVMERMGV
GMFLSIIAIVIAAIVERKRLAISQKMKTLPDYDPETVPLSIFWLLPQYILLGISDIFTVVGMQEFFYSEVPVRMRTMGFA
LYTSVFGVGSFVSAALISIVEAYSSSTGDRQNWFADDMSEARLDKYYWLLALTSTISFVVYIFLCKFFKSSSDQGDEKEE
APK*

DNA
ATGGATTTAGAACAGAAGACAAGAGGACTTAGCAAGTCATGTGCCCTTCTCATAGTGATTGCGGGAATGGAGAGATATGC
ATTCAAAGGAGTTGCATCAAACTTAGTGACATATCTAACAGATGTAGTGAAGATGAGTAATTCAAGAGCAGCCAAAACTG
TTAACACTTGGGCTGGTTTCACTTCTATGTTGCCTCTCTTCTCTGCTCCTTTGGCTGATACTTATTGGGACAGATTCTTC
ACCATCCTTGCTTCTTCTTCCGTCTACTTTGTGGGACTAGTGGGATTGACATGGACGGCATTTGCTGGGTCACGTTCAGC
TACTAAGACTATCTCTTCTTACTTTCTCTACTCTTCACTATGTCTTGTCTCAATCGGTTTAGGCGTCTTAAACCCTTCTC
TTCAAGCCTTTGGTGCAGACCAACTCGACCACGACCTCGATAAGAATTTCGATCTTTCCTCGGGTGATCAAAAGGACGCG
AAAGCTACCCGAAAGACTCAGTTTTTCCAATTGTGGTACTTTGGCGTCTGCACCGGCAGCCTTATGGGTGTCACAGTCAT
GGCTTATATTCAAGACACTTTTGGTTGGGTTCTCGGTTTCGCCATTCCTGGTATCGTGATATTCCTGTCGATTTTGGTGT
TCATGTCGGGTTGTGGAATTTATGTTTATGCTCCGGGCGCCCGTCTGAAGAAGAAAACAACTACTACACCTTTTGAGAAG
ATTCTTAAATTCATTAAAGGGAGAGTAGTGAAGCAGAGAAGCATATATACACTTGCAGATGAGAAAGATTTGGATGCTAT
GGAGCTTGAGCTAGAGGAGAGGCCTCTCTGTAAATGTGAGACCGAAGACATTGAGACTCCTTCAACAACCTCCAAAGGAT
TGGAAGATGACGAGAGCTCGAAAACGGTTTTCTCTGGAATTGATAATGTTAAGTTAGTGATTCGCCTTTTCCCCATATGG
ATGATGCTTCTCATGTTCGCGGTTATCTTCCAGCTACCAGCAACCTTTTTCACCAAACAAGGTGTGACTATGAAGAGAAA
CATTGGGTCCAACTTCAAAATCCCACCTGCAACCCTGCAAAGCACGATCACATTATCAATCATCCTGCTTATGCCATTAT
ATGATAAGATTTTGATACCTATTACCAAGAGAATCAAGAAAAACGGTACAGGTATCTCTGTGATGGAGAGAATGGGAGTC
GGAATGTTTCTATCCATCATTGCCATTGTTATTGCGGCAATAGTCGAAAGGAAAAGACTAGCCATAAGCCAAAAGATGAA
GACTTTACCTGATTATGATCCAGAAACCGTCCCACTGAGCATCTTCTGGCTGCTGCCTCAGTACATCCTCTTGGGAATCT
CAGATATATTCACAGTCGTTGGGATGCAAGAGTTTTTCTACAGTGAGGTTCCTGTAAGAATGAGAACAATGGGATTTGCT
CTCTACACAAGTGTTTTTGGTGTTGGAAGCTTTGTGAGCGCCGCACTGATCTCAATTGTCGAGGCTTACTCGAGCTCAAC
AGGTGACCGACAAAACTGGTTTGCAGATGATATGTCGGAAGCTCGGCTTGACAAATACTACTGGCTTCTTGCTCTTACAA
GTACAATAAGCTTTGTAGTCTACATATTTCTATGCAAGTTTTTCAAGAGTAGCAGTGATCAAGGCGATGAAAAAGAAGAA
GCCCCTAAATGA