Details for Arabidopsis Locus AT3G01340

Position : Chr3 ( 5`- 127348 .. 128994 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01340

Protein [Map View]
MPPQKIETGHSDTIHDVVMDYYGKRVATASSDCTIKITGVSNSGGSQHLATLTGHRGPVWQVAWAHPKFGSLLASCSYDG
QIILWKEGNQNQWTQAHVFTDHKVSVNSIAWAPHELGLSLACGASDGNISVFSARADGGWDTTKIDQAHPVGVTSVSWAP
ATEPGALVSSGMIDPVYKLASGGCDSTVKVWKFSNGSWKMDCFPALNKHTDWVRDVAWAPNLGLPKSTIASGSEDGKVII
WTIGKEGEQWEGTVLKDFKTPVWRVSWSLTGNLLAVSDGNNNVTVWKESVDGEWEQVTVVEP*

DNA
ATGCCTCCTCAGAAGATTGAAACTGGTCATAGCGACACTATTCATGATGTGGTCATGGATTACTATGGAAAGCGAGTAGC
AACTGCCTCGTCTGACTGCACGATCAAGATAACCGGAGTAAGCAACAGCGGTGGATCTCAGCATCTAGCTACCTTAACCG
GTCATCGAGGTCCTGTCTGGCAAGTCGCTTGGGCGCACCCAAAGTTTGGTTCACTTCTCGCTTCATGTTCCTATGATGGG
CAAATTATATTATGGAAAGAAGGTAACCAAAACCAATGGACACAAGCTCATGTCTTCACAGACCACAAAGTATCTGTCAA
CTCTATCGCTTGGGCTCCTCATGAACTTGGACTCTCCTTAGCTTGCGGAGCATCTGATGGAAACATATCAGTTTTCTCGG
CTCGAGCTGATGGCGGTTGGGACACGACAAAGATAGACCAAGCACACCCTGTTGGTGTCACTTCAGTGTCGTGGGCACCG
GCCACAGAACCAGGCGCACTCGTTAGCTCTGGTATGATCGATCCGGTCTACAAACTAGCATCCGGCGGGTGTGATAGCAC
GGTGAAAGTGTGGAAGTTCTCGAACGGGTCATGGAAAATGGATTGTTTCCCGGCTCTCAACAAGCACACGGATTGGGTCC
GTGATGTGGCTTGGGCACCGAACTTGGGTCTCCCAAAGTCAACCATAGCCAGTGGTTCAGAAGATGGGAAAGTGATCATA
TGGACCATAGGGAAAGAAGGTGAGCAATGGGAAGGTACTGTTTTGAAAGATTTCAAAACACCAGTGTGGCGGGTCTCGTG
GTCGTTGACCGGTAATTTGTTGGCTGTTTCCGATGGGAACAATAACGTTACAGTGTGGAAAGAGTCTGTTGATGGAGAGT
GGGAACAAGTGACTGTTGTTGAGCCATAG