Details for Arabidopsis Locus AT3G01330

Position : Chr3 ( 5`- 124379 .. 126835 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01330

Protein [Map View]
MSSAIVVSQDAESLGLQIYSRKEKSLGVLVSNFLRLYNRDDVDLIGLDDAAGQLGVERRRIYDVVNILESIGIVARRGKN
QYSWKGFGEIPRSLDELKEEGMRERLGYSSSNNSDKVSNGCEREEPLTLTPDDQENSSSSKMDQKKEKSLWLLAQNFVKM
FLCSDDDLITLDSAAKALLSDSPDSVHMRTKVRRLYDIANVFASMNLIEKTHIPVTRKPAYRWLGSKSIAERGLSLFNSG
EPKRVFGTEITNLRAKRNKTYCSSIRKQIGYKKHDEENTEQESKPAASKYVFGPFSPIGASKTNNDKVGKGRLLEIEALA
STYQPQYCNQEITGLLGHFTEAWKKWYAEVDRNK*

DNA
ATGTCTTCTGCGATTGTTGTTTCTCAAGATGCGGAATCGCTTGGTCTGCAAATTTATAGCCGCAAGGAGAAATCTCTTGG
GGTTCTCGTCTCCAATTTCCTGAGACTGTATAACCGAGACGATGTGGATCTCATTGGGCTCGATGATGCCGCTGGGCAAT
TAGGAGTTGAAAGGCGGCGTATCTATGATGTGGTCAATATATTGGAGAGTATTGGGATTGTGGCAAGAAGAGGGAAGAAT
CAATACTCGTGGAAAGGTTTTGGAGAGATTCCTCGTTCTCTAGATGAACTCAAGGAAGAAGGGATGAGAGAGAGGTTAGG
TTACTCAAGTTCAAACAATTCAGACAAGGTTTCAAATGGTTGTGAAAGAGAAGAACCTTTAACTTTAACACCTGATGATC
AGGAGAACTCATCATCCTCTAAAATGGACCAAAAGAAGGAAAAATCTCTCTGGCTTCTCGCACAGAATTTTGTGAAGATG
TTTCTATGTTCTGATGATGATCTCATCACACTTGATAGTGCTGCAAAAGCCTTGCTGAGCGACTCTCCAGATTCAGTCCA
TATGCGAACTAAAGTTAGAAGACTTTACGACATTGCAAATGTATTTGCCTCGATGAATTTAATCGAGAAGACTCATATAC
CAGTGACTAGGAAACCAGCATATAGGTGGTTAGGGTCCAAAAGCATAGCTGAAAGAGGATTAAGCTTATTTAATTCCGGA
GAACCGAAGCGGGTATTTGGAACAGAGATCACAAACTTGAGGGCAAAGAGAAACAAAACATATTGTTCATCAATCCGCAA
GCAAATTGGATATAAGAAACATGACGAGGAAAACACAGAGCAGGAATCGAAACCAGCTGCAAGTAAATATGTGTTTGGCC
CGTTCTCCCCAATAGGAGCATCTAAGACGAACAACGACAAAGTCGGAAAGGGAAGGTTACTAGAGATCGAGGCCCTTGCT
TCTACCTACCAACCACAGTATTGCAATCAAGAAATAACTGGTCTTCTTGGGCATTTCACGGAGGCATGGAAGAAATGGTA
TGCAGAGGTTGATCGGAATAAATAA