Details for Arabidopsis Locus AT3G01322

Position : Chr3 ( 5`- 114290 .. 114604 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01322

Protein [Map View]
MKSKQIKMMFFLLIVVSALILRPSKAQIKTSICSRTQTRPIDNVDGCFDAVRLAADVDIKWLSRDCCKAVKTLDDCLLLV
FPNRAYNTNLFKEICFEIFNNLIL*

DNA
ATGAAATCAAAGCAAATCAAAATGATGTTCTTTTTATTAATTGTAGTTTCAGCTTTGATTTTGCGACCGTCCAAAGCTCA
GATAAAAACGAGCATATGTTCAAGAACACAGACAAGGCCGATAGATAACGTGGATGGATGTTTCGATGCGGTGAGATTAG
CTGCGGATGTAGATATCAAATGGCTATCAAGAGACTGTTGCAAAGCAGTGAAAACACTTGATGATTGCCTTTTGCTTGTA
TTTCCCAACAGAGCTTACAATACTAATCTCTTCAAAGAAATTTGTTTCGAAATTTTCAATAACTTAATTTTATGA