Details for Arabidopsis Locus AT3G01300

Position : Chr3 ( 5`- 90598 .. 93585 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01300

Protein [Map View]
MGFDSVKVMENWQSKTSNENEKKKKKRRRKKNNNVRNSEHYEEEANGCWVKFRYIVCCASSTSDVETSLTLSTSTVGSQS
AIVQSNDQPVGPVSSTTTTSNAESSLSTPIISEELNIYSHLKKFSFIDLKLATRNFRPESLLGEGGFGCVFKGWVEENGT
APVKPGTGLTVAVKTLNPDGLQGHKEWLAEINYLGNLLHPNLVKLVGYCIEDDQRLLVYEFMPRGSLENHLFRRSLPLPW
SIRMKIALGAAKGLSFLHEEALKPVIYRDFKTSNILLDGEYNAKLSDFGLAKDAPDEGKTHVSTRVMGTYGYAAPEYVMT
GHLTSKSDVYSFGVVLLEMLTGRRSMDKNRPNGEHNLVEWARPHLLDKRRFYRLLDPRLEGHFSVKGAQKVTQLAAQCLS
RDSKIRPKMSEVVEVLKPLPHLKDMASASYYFQTMQAERLKAGSGSGSGRGFGSRNGQPVFRTLSSPHGQAGSSPYRHQI
PSPKPKGATT*

DNA
ATGGGTTTCGATTCTGTTAAAGTTATGGAGAATTGGCAATCCAAGACATCTAATGAGAATGAGAAGAAGAAGAAGAAGCG
GAGGAGGAAGAAGAACAACAATGTCAGAAACAGTGAACATTATGAAGAAGAAGCAAATGGGTGTTGGGTCAAATTTAGGT
ATATAGTCTGTTGCGCTTCTTCAACATCAGACGTTGAGACCTCTCTCACTCTCTCTACTAGCACTGTGGGAAGTCAGTCC
GCAATTGTGCAATCAAATGACCAACCGGTTGGCCCAGTCTCTTCTACTACTACAACTAGCAATGCAGAAAGCTCTTTGTC
CACTCCTATCATAAGTGAAGAACTTAACATCTATTCTCACCTTAAGAAGTTTTCTTTCATTGATCTCAAGTTGGCTACTA
GAAATTTCAGACCTGAAAGCCTTCTCGGAGAAGGTGGCTTTGGTTGTGTCTTCAAAGGCTGGGTCGAGGAGAACGGAACT
GCTCCTGTTAAGCCTGGCACTGGCCTTACTGTTGCCGTCAAAACCTTAAATCCTGATGGCCTTCAGGGTCATAAAGAGTG
GCTTGCTGAGATTAATTATCTTGGTAATCTTCTCCATCCCAATCTTGTTAAACTGGTGGGTTATTGTATCGAAGATGATC
AAAGGCTGCTTGTATATGAGTTTATGCCTCGAGGAAGTTTGGAGAATCACCTTTTCAGAAGGTCCTTGCCTCTTCCATGG
TCAATTCGGATGAAGATTGCATTAGGTGCTGCAAAGGGTCTCAGTTTCCTTCACGAAGAAGCTTTAAAGCCGGTCATTTA
TCGAGATTTCAAAACCTCAAATATTTTACTGGATGGGGAGTACAATGCTAAATTATCAGATTTTGGGCTTGCCAAAGATG
CTCCTGATGAAGGCAAAACTCATGTGTCTACTCGAGTCATGGGCACTTATGGTTACGCTGCCCCCGAGTATGTAATGACC
GGTCACTTGACATCAAAAAGCGACGTTTACAGTTTCGGTGTGGTTCTTCTCGAAATGCTGACTGGTAGAAGATCAATGGA
CAAAAATCGACCAAACGGTGAACACAACCTCGTTGAATGGGCGAGACCGCATCTCCTGGACAAAAGAAGATTCTACCGGT
TACTTGATCCGAGGCTGGAGGGTCATTTCTCAGTTAAAGGAGCACAAAAAGTGACTCAGCTTGCAGCACAATGCCTTAGC
CGTGACTCCAAAATAAGACCCAAAATGAGTGAAGTGGTGGAAGTACTTAAGCCTCTCCCACACCTCAAGGACATGGCTAG
CGCTTCTTACTACTTCCAGACAATGCAAGCTGAACGTTTGAAAGCTGGTTCTGGTTCTGGTTCTGGTCGTGGATTCGGGT
CAAGAAACGGGCAACCAGTGTTTCGGACATTGTCTAGTCCTCATGGTCAAGCTGGTTCGTCGCCTTATCGTCATCAGATT
CCGTCTCCTAAGCCTAAAGGTGCAACTACTTAG