Details for Arabidopsis Locus AT3G01280

Position : Chr3 ( 5`- 85601 .. 87858 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01280

Protein [Map View]
MVKGPGLYTEIGKKARDLLYKDHNSDQKFSITTFSPAGVAITSTGTKKGDLLLGDVAFQSRRKNITTDLKVCTDSTFLIT
ATVDEAAPGLRSIFSFKVPDQNSGKVELQYLHEYAGISTSMGLTQNPTVNFSGVIGSNVLAVGTDVSFDTKSGNFTKINA
GLSFTKEDLIASLTVNDKGDLLNASYYHIVNPLFNTAVGAEVSHKLSSKDSTITVGTQHSLDPLTSVKARVNSAGIASAL
IQHEWKPKSFFTISGEVDTKSIDKSAKVGLALALKP*

DNA
ATGGTGAAAGGTCCCGGTCTCTACACCGAAATCGGCAAAAAGGCCAGAGATCTTCTGTACAAAGACCACAACAGTGACCA
GAAATTCAGTATCACCACTTTCTCTCCTGCCGGTGTTGCCATCACCTCAACCGGAACTAAGAAAGGTGACTTATTGTTGG
GAGATGTCGCTTTTCAGTCGAGGCGAAAGAACATTACTACTGATTTGAAAGTTTGCACTGATTCTACTTTTCTGATCACC
GCTACCGTTGATGAGGCTGCACCCGGACTGAGGTCAATCTTCAGCTTCAAGGTTCCTGACCAAAATTCTGGCAAGGTTGA
GCTGCAATACTTGCATGAGTACGCCGGTATCAGCACAAGCATGGGATTGACTCAGAACCCAACTGTCAACTTCTCTGGTG
TGATTGGCTCCAATGTCTTGGCTGTTGGTACTGATGTTTCATTTGACACCAAGTCTGGAAATTTCACCAAGATCAATGCT
GGTTTAAGCTTCACCAAGGAGGACTTAATTGCCTCCCTTACTGTGAACGACAAGGGCGATCTATTGAATGCATCTTACTA
TCACATTGTGAACCCGCTGTTCAACACTGCGGTTGGAGCCGAAGTGAGCCACAAGTTATCTAGCAAGGACAGCACCATAA
CTGTTGGAACACAGCACTCGCTTGACCCCTTGACCTCTGTGAAGGCTCGTGTCAATAGTGCGGGTATTGCAAGTGCTCTC
ATTCAACACGAGTGGAAACCCAAGTCATTCTTCACAATCTCTGGAGAAGTCGACACAAAGTCAATTGACAAGAGTGCTAA
AGTTGGATTGGCTCTCGCACTCAAGCCTTGA