Details for Arabidopsis Locus AT3G01250

Position : Chr3 ( 5`- 79305 .. 80105 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01250

Protein [Map View]
MAKNSYALSGLIVALVIALVCNIDDAAARDVKLVKLRDVKPETLNKLKGEKESELMQAEEKNNLLKEIEKAKKLLGELKT
LKKQSTGDMKSELKSLVKSESLLNEISDSLKNGTYNHIKANIFVEKESFFYRAWKENAYNSVVPEKEKEYMSTIKRIVKL
VKKT*

DNA
ATGGCAAAGAATTCTTATGCACTGTCTGGGTTAATTGTGGCCCTAGTCATCGCATTGGTATGCAACATTGATGACGCTGC
AGCGAGAGACGTGAAGCTAGTGAAGCTCCGCGATGTAAAACCCGAAACTTTGAACAAGTTGAAAGGAGAAAAAGAAAGTG
AACTCATGCAAGCAGAGGAGAAAAACAATCTTCTAAAGGAAATTGAGAAGGCAAAGAAATTGCTCGGAGAATTGAAAACG
TTAAAGAAGCAATCAACTGGTGATATGAAAAGCGAATTGAAATCTTTGGTGAAATCTGAATCGTTACTTAATGAAATTTC
AGATTCTCTGAAGAATGGAACGTACAACCATATTAAAGCAAACATTTTTGTTGAAAAAGAATCATTTTTCTACAGAGCAT
GGAAGGAGAATGCCTATAATTCGGTGGTTCCGGAGAAGGAGAAAGAGTATATGTCTACCATAAAACGCATTGTCAAGTTG
GTGAAGAAAACTTAG