Details for Arabidopsis Locus AT3G01190

Position : Chr3 ( 5`- 67058 .. 68536 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01190

Protein [Map View]
MAASKRLVVSCLFLVLLFAQANSQGLKVGFYSKTCPQLEGIVKKVVFDAMNKAPTLGAPLLRMFFHDCFVRGCDGSVLLD
KPNNQGEKSAVPNLSLRGFGIIDDSKAALEKVCPGIVSCSDILALVARDAMVALEGPSWEVETGRRDGRVSNINEVNLPS
PFDNITKLISDFRSKGLNEKDLVILSGGHTIGMGHCPLLTNRLYNFTGKGDSDPSLDSEYAAKLRKKCKPTDTTTALEMD
PGSFKTFDLSYFTLVAKRRGLFQSDAALLDNSKTRAYVLQQIRTHGSMFFNDFGVSMVKMGRTGVLTGKAGEIRKTCRSA
N*

DNA
ATGGCAGCTTCTAAGCGACTAGTTGTCTCTTGCTTGTTCTTAGTTTTGTTGTTTGCTCAAGCCAATTCGCAAGGTTTGAA
AGTAGGTTTCTACAGCAAAACATGCCCACAACTCGAGGGTATAGTTAAAAAGGTCGTGTTCGATGCGATGAACAAAGCAC
CAACACTTGGTGCTCCTTTGCTTAGAATGTTCTTCCACGACTGCTTCGTTCGGGGATGTGACGGATCAGTTTTGTTAGAT
AAACCAAACAATCAAGGTGAGAAGAGTGCAGTTCCTAACCTAAGTCTTCGAGGGTTTGGCATCATAGACGATTCCAAGGC
GGCTCTAGAAAAAGTGTGTCCGGGAATTGTTTCTTGCTCTGATATCTTGGCACTTGTCGCTAGAGACGCAATGGTTGCAC
TTGAAGGACCATCATGGGAAGTTGAAACGGGAAGAAGAGACGGTAGGGTTTCTAACATCAACGAAGTCAACTTGCCATCA
CCTTTTGATAACATCACCAAGCTTATCAGCGATTTTCGCTCAAAGGGCCTCAACGAGAAGGATCTAGTCATTCTCTCGGG
TGGTCACACAATTGGAATGGGACATTGTCCTTTATTGACAAACCGGCTTTACAACTTCACCGGAAAAGGAGACAGCGACC
CAAGTTTGGACTCGGAGTACGCCGCTAAGCTCAGGAAGAAATGCAAGCCCACCGATACGACGACGGCTCTAGAGATGGAT
CCGGGGAGTTTCAAAACATTTGACTTGAGCTACTTCACGCTAGTGGCTAAGAGAAGAGGACTTTTCCAGTCGGATGCTGC
TCTACTCGACAACTCCAAGACTAGGGCTTATGTCTTGCAACAGATAAGAACTCATGGGTCAATGTTCTTTAACGACTTTG
GTGTCTCTATGGTGAAAATGGGTCGGACTGGAGTTCTTACGGGTAAGGCCGGGGAGATCCGTAAGACGTGTCGGTCTGCT
AATTAA