Details for Arabidopsis Locus AT3G01130

Position : Chr3 ( 5`- 44045 .. 45590 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01130

Protein [Map View]
MAPPPGLYSGTSTLALVARASAFGLGLIYGNIKLKALKIKKNSQIKAEAKAHH*

DNA
ATGGCGCCACCTCCAGGACTTTACTCCGGTACCAGCACTCTTGCTCTGGTTGCTCGTGCTTCGGCTTTCGGGTTGGGTCT
CATCTACGGCAACATCAAGCTCAAGGCTTTAAAGATAAAGAAGAATTCGCAGATTAAGGCCGAAGCAAAGGCTCATCACT
AA