Details for Arabidopsis Locus AT3G01120

Position : Chr3 ( 5`- 38759 .. 41932 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01120

Protein [Map View]
MAVSSFQCPTIFSSSSISGFQCRSDPDLVGSPVGGSSRRRVHASAGISSSFTGDAGLSSRILRFPPNFVRQLSIKARRNC
SNIGVAQIVAAKWSNNPSSALPSAAAAAATSSASAVSSAASAAAASSAAAAPVAAAPPVVLKSVDEEVVVAEEGIREKIG
SVQLTDSKHSFLSSDGSLTVHAGERLGRGIVTDAITTPVVNTSAYFFKKTAELIDFKEKRSVSFEYGRYGNPTTVVLEDK
ISALEGAESTLVMASGMCASTVMLLALVPAGGHIVTTTDCYRKTRIFMENFLPKLGITVTVIDPADIAGLEAAVNEFKVS
LFFTESPTNPFLRCVDIELVSKICHKRGTLVCIDGTFATPLNQKALALGADLVVHSATKYIGGHNDVLAGCICGSLKLVS
EIRNLHHVLGGTLNPNAAYLIIRGMKTLHLRVQQQNSTAFRMAEILEAHPKVSHVYYPGLPSHPEHELAKRQMTGFGGVV
SFEIDGDIETTIKFVDSLKIPYIAPSFGGCESIVDQPAIMSYWDLPQEERLKYGIKDNLVRFSFGVEDFEDVKADILQAL
EAI*

DNA
ATGGCCGTCTCATCATTCCAGTGCCCTACCATCTTCTCCTCCTCCTCAATCTCCGGCTTTCAATGCCGTTCTGATCCAGA
TCTCGTCGGTTCTCCCGTCGGTGGATCATCTCGCCGTCGTGTCCATGCCTCCGCCGGGATTTCTTCCTCATTCACCGGGG
ACGCTGGATTATCCTCCAGGATCTTAAGATTTCCTCCTAATTTCGTCCGTCAGCTGAGCATTAAAGCCCGTAGAAACTGT
AGCAACATCGGTGTTGCACAGATCGTGGCGGCTAAGTGGTCCAACAACCCATCCTCCGCGTTACCTTCGGCGGCGGCGGC
TGCTGCTACCTCGTCTGCATCTGCGGTTTCTTCCGCCGCATCTGCAGCCGCAGCCTCGTCCGCCGCCGCCGCCCCTGTGG
CTGCCGCGCCTCCCGTCGTGCTGAAAAGCGTCGATGAGGAGGTTGTGGTGGCCGAGGAGGGGATCAGGGAGAAGATAGGT
AGTGTACAGCTGACGGATTCCAAACATTCTTTCTTGAGCTCCGATGGGAGCCTCACTGTTCATGCCGGTGAAAGATTAGG
CCGTGGTATAGTGACGGATGCTATCACTACTCCTGTAGTCAACACATCTGCCTACTTCTTCAAGAAAACTGCTGAGCTTA
TTGACTTCAAGGAGAAAAGGAGTGTGAGTTTCGAGTATGGTCGTTATGGTAACCCTACGACTGTGGTACTTGAAGATAAG
ATAAGTGCACTTGAAGGGGCTGAATCAACTTTGGTTATGGCATCTGGGATGTGTGCAAGCACTGTTATGCTTTTGGCATT
GGTTCCTGCTGGTGGACACATTGTCACTACTACTGATTGCTACAGGAAGACTAGGATCTTCATGGAGAATTTTCTTCCCA
AGTTGGGGATCACTGTCACTGTGATTGATCCTGCTGATATCGCAGGGCTTGAAGCTGCAGTGAATGAGTTCAAGGTATCT
CTGTTCTTCACTGAGTCCCCGACAAACCCATTCCTTAGATGTGTCGACATTGAGCTAGTTTCAAAAATATGCCACAAGAG
GGGAACTCTGGTTTGCATTGATGGCACCTTTGCAACACCTCTGAATCAGAAAGCCCTTGCTCTTGGTGCTGATCTTGTCG
TGCACTCTGCTACAAAGTACATTGGAGGACACAATGATGTTCTTGCTGGATGCATCTGTGGTTCACTGAAGTTGGTTTCA
GAAATTCGCAATCTGCATCATGTGTTGGGAGGAACACTTAACCCAAACGCTGCGTACCTAATCATCCGAGGCATGAAGAC
ATTGCATCTTCGTGTACAGCAACAGAATTCGACCGCTTTTAGAATGGCCGAAATTTTAGAGGCACATCCTAAGGTGAGTC
ATGTGTACTATCCAGGCCTTCCAAGTCATCCCGAACATGAACTCGCCAAGCGACAAATGACTGGTTTTGGAGGTGTGGTC
AGTTTCGAGATTGATGGAGACATTGAAACGACAATCAAGTTTGTGGATTCTCTAAAGATTCCTTACATTGCACCATCCTT
CGGTGGCTGCGAAAGCATTGTTGACCAACCTGCTATCATGTCCTACTGGGATCTGCCGCAAGAGGAGAGACTAAAGTATG
GAATCAAAGATAACTTGGTTCGTTTCAGCTTTGGAGTTGAAGACTTTGAAGATGTCAAAGCTGACATTCTTCAAGCTCTC
GAAGCCATCTGA