Details for Arabidopsis Locus AT3G01070

Position : Chr3 ( 5`- 19592 .. 20719 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G01070

Protein [Map View]
MARVAVLVAGAVLAFLLAATNVTAKRWTVGDNKFWNPNINYTIWAQDKHFYLDDWLYFVYERNQYNVIEVNETNYISCNP
NNPIANWSRGAGRDLVHLNVTRHYYLISGNGGGCYGGMKLAVLVEKPPPPPAAAPNKNSARRTFSVSGFAYQFLIPVAVF
AAVGTRY*

DNA
ATGGCGAGAGTTGCGGTTTTGGTTGCAGGGGCGGTGCTGGCTTTTCTGCTGGCGGCGACGAATGTGACGGCGAAGAGGTG
GACGGTGGGTGATAACAAGTTCTGGAATCCTAATATCAACTATACCATTTGGGCTCAGGACAAACATTTCTACCTCGACG
ATTGGCTCTATTTTGTATATGAGAGAAACCAATACAACGTTATAGAAGTGAACGAGACGAACTACATAAGCTGCAATCCC
AATAACCCGATCGCAAATTGGAGTCGTGGAGCTGGAAGGGACTTGGTTCATCTCAATGTGACAAGGCATTACTATCTGAT
TAGTGGTAATGGTGGTGGATGTTACGGAGGTATGAAGCTCGCTGTTTTAGTTGAGAAACCGCCTCCTCCACCAGCTGCAG
CACCTAACAAGAACAGTGCAAGAAGAACCTTCTCGGTCTCCGGTTTTGCCTATCAGTTTCTTATTCCAGTAGCTGTTTTC
GCAGCAGTTGGGACACGGTACTGA