Details for Arabidopsis Locus AT2G40960

Position : Chr2 ( 5`- 17095522 .. 17097454 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40960

Protein [Map View]
MDTALTSESGCAVIADKGFNVDPFLVEALQNPRHRLTILRMELDVQRFLQSPDQQQFEFQHFPTSYLRFAAHRVANHYGL
ITSVRDGGADGNESRIVVTKSSDSRFPAARLSEIPVKQSETGKFEHMKVVIKPRPTKGSGMEGDELKGGLLKSVEERKED
YDRARARIFNGLVNIDCNDSSSETNPWRVNCSSSRDENQVLKNGNIEADKNNISRKSNPASRIAILRDREKDRYDPDYDR
SNYRYISNLPVDQNLCVAHFNIQTMGTPIYDMGFRGYSPTAPPSLNLGQHSVMSPCVTTGLNQPSRDAAMYMQWPNAAAV
MYTHSYDHFRNSPFQAQFYPQPLSFDYMQNR*

DNA
ATGGACACAGCATTGACCTCAGAATCAGGCTGTGCCGTTATAGCCGATAAGGGATTCAATGTGGATCCTTTTTTGGTCGA
GGCTCTTCAAAACCCTCGACATCGTCTAACGATTTTGCGGATGGAACTTGATGTTCAGAGGTTCTTGCAGAGCCCTGATC
AGCAGCAATTCGAGTTCCAGCATTTCCCTACATCATACCTCCGTTTTGCGGCTCATCGTGTTGCTAATCACTATGGACTA
ATTACATCAGTTCGAGATGGTGGTGCAGATGGTAATGAGAGCAGAATTGTCGTGACTAAATCTAGTGATAGCAGATTTCC
TGCTGCTCGACTATCTGAAATCCCTGTGAAACAGTCAGAAACTGGCAAGTTTGAGCATATGAAAGTTGTTATAAAGCCAA
GACCTACTAAAGGATCTGGAATGGAAGGTGATGAACTGAAAGGTGGTCTTCTGAAAAGTGTTGAAGAGAGGAAAGAAGAT
TACGACAGGGCTCGAGCACGCATATTTAACGGTCTTGTGAACATTGATTGTAACGATTCTTCATCTGAAACTAATCCTTG
GAGGGTGAATTGTAGTTCTAGCAGAGATGAAAATCAAGTGTTGAAGAATGGTAATATCGAAGCAGACAAGAACAATATCT
CTAGGAAGAGCAATCCTGCATCTCGTATTGCAATTCTCAGAGACAGAGAGAAAGATCGATATGACCCTGACTATGACCGC
AGCAATTACAGGTACATTAGTAACCTCCCAGTCGATCAAAATTTATGCGTGGCACACTTCAACATTCAGACAATGGGGAC
ACCAATCTATGATATGGGATTTAGAGGGTATAGTCCAACTGCTCCTCCATCTCTTAACTTGGGTCAACATTCTGTCATGA
GCCCCTGCGTCACCACAGGTTTAAACCAGCCTTCAAGAGATGCTGCTATGTACATGCAATGGCCAAATGCAGCAGCTGTG
ATGTATACTCATTCATATGACCACTTCAGAAACTCCCCTTTTCAGGCGCAGTTCTATCCGCAGCCCCTTAGTTTCGATTA
CATGCAGAACCGGTAA