Details for Arabidopsis Locus AT2G40950

Position : Chr2 ( 5`- 17087620 .. 17090424 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40950

Protein [Map View]
MAEPITKEQPPPPAPDPNSTYPPPSDFDSISIPPLDDHFSDQTPIGELMSDLGFPDGEFELTFDGMDDLYFPAENESFLI
PINTSNQEQFGDFTPESESSGISGDCIVPKDADKTITTSGCINRESPRDSDDRCSGADHNLDLPTPLSSQGSGNCGSDVS
EATNESSPKSRNVAVDQKVKVEEAATTTTSITKRKKEIDEDLTDESRNSKYRRSGEDADASAVTGEEDEKKRARLMRNRE
SAQLSRQRKKHYVEELEEKVRNMHSTITDLNGKISYFMAENATLRQQLGGNGMCPPHLPPPPMGMYPPMAPMPYPWMPCP
PYMVKQQGSQVPLIPIPRLKPQNTLGTSKAKKSESKKSEAKTKKVASISFLGLLFCLFLFGALAPIVNVNYGGISGAFYG
NYRSNYITDQIYSQHRDRVLDTSRSGAGTGVSNSNGMHRGRDSDRGARKNISATESSVTPGNGSEPLVASLFVPRNDKLV
KIDGNLIINSILASEKAVASRKASESKERKADLMISKDYTPALPLPDVGRTEELAKHLYRSKAEKQKALSSGSADTLKDQ
VKTKAANGEMQQWFREGVAGPMFSSGMCTEVFQFDVSSTSGAIIPAATNVSAEHGKNTTDTHKQQNRRILRGLPIPLPGS
DFNLTKEHQRNSSSKEIKPASSMVVSVLVDPREGGDGDIDGMIGGPKSLSRVFVVVLLDSAKYVTYSCVLPRSGAPHLVT
T*

DNA
ATGGCTGAACCAATCACCAAGGAGCAGCCTCCTCCACCTGCTCCGGACCCTAATTCCACCTACCCTCCTCCGTCCGATTT
TGATTCCATCTCGATCCCTCCGTTAGATGATCATTTCTCCGATCAGACTCCGATTGGTGAACTAATGTCCGATCTGGGGT
TTCCCGATGGTGAATTCGAGCTCACTTTCGACGGTATGGACGATCTTTACTTCCCTGCTGAGAATGAGTCGTTTCTCATC
CCTATCAATACGTCCAATCAAGAACAGTTTGGTGATTTCACTCCGGAGTCTGAAAGTTCTGGAATTTCCGGTGATTGTAT
TGTTCCCAAAGATGCAGATAAGACTATTACAACTTCCGGTTGCATTAACCGGGAATCTCCTAGAGATTCCGATGATCGTT
GCTCCGGTGCTGACCATAATTTAGATCTACCGACTCCATTGTCCTCTCAGGGTTCGGGTAATTGCGGTTCTGATGTTTCG
GAAGCTACAAATGAATCGTCGCCTAAATCGAGAAACGTTGCGGTCGACCAGAAGGTTAAAGTGGAAGAAGCTGCTACGAC
GACGACGTCTATTACCAAGAGGAAGAAAGAGATCGATGAGGATTTGACTGACGAGTCTAGGAACAGTAAGTACAGGAGAT
CGGGAGAGGATGCTGACGCTAGTGCTGTTACCGGTGAAGAAGATGAGAAAAAGAGAGCTAGACTCATGAGAAACCGTGAA
AGTGCTCAGCTTTCTAGGCAGAGGAAGAAGCATTACGTCGAGGAGCTTGAAGAAAAGGTTAGGAATATGCATTCTACGAT
TACGGATTTGAACGGTAAGATATCGTATTTCATGGCTGAGAATGCTACTCTAAGGCAGCAATTGGGTGGCAATGGAATGT
GCCCGCCGCATCTTCCACCACCTCCGATGGGAATGTATCCACCTATGGCTCCAATGCCTTATCCATGGATGCCTTGTCCT
CCTTATATGGTGAAGCAACAAGGATCTCAAGTGCCTTTGATTCCTATTCCTAGGTTGAAACCACAGAACACCCTTGGAAC
ATCCAAGGCTAAGAAGTCCGAGAGTAAGAAGAGTGAAGCTAAGACCAAGAAGGTGGCTAGTATTAGTTTTCTGGGTCTTC
TGTTTTGTCTATTTTTGTTTGGTGCATTAGCTCCAATTGTGAACGTTAATTATGGAGGAATTAGTGGTGCTTTTTATGGG
AACTATAGATCTAATTATATTACTGACCAGATTTACAGTCAGCATAGGGATAGAGTTTTGGATACATCTCGTAGTGGTGC
TGGTACTGGGGTTTCTAATAGTAATGGGATGCATCGTGGGAGAGATTCTGATCGAGGAGCTAGGAAAAATATATCTGCAA
CAGAGAGTTCTGTCACTCCTGGAAATGGTAGTGAGCCTCTAGTTGCATCACTCTTTGTTCCGAGGAATGACAAGCTTGTG
AAGATAGATGGGAATTTGATTATCAATTCTATATTGGCGAGTGAGAAAGCCGTGGCTTCGAGAAAGGCTTCTGAATCAAA
GGAGAGGAAAGCTGACTTGATGATCTCTAAAGATTATACCCCTGCACTGCCTCTACCTGACGTGGGAAGGACAGAGGAAT
TGGCTAAGCATCTCTATAGATCTAAGGCTGAAAAACAGAAAGCTCTATCCTCTGGCTCTGCTGATACTCTGAAAGACCAA
GTCAAAACAAAAGCAGCCAACGGTGAAATGCAGCAATGGTTCCGTGAAGGTGTTGCAGGTCCCATGTTTAGTTCAGGGAT
GTGCACTGAAGTGTTTCAGTTTGATGTATCCTCAACCTCTGGAGCCATCATTCCTGCAGCTACCAACGTCTCTGCTGAAC
ACGGTAAGAACACCACAGACACACACAAGCAACAGAACAGAAGAATCCTTCGTGGTCTTCCCATTCCACTCCCAGGATCA
GATTTTAACCTCACGAAAGAGCACCAAAGAAACAGCAGTAGCAAAGAAATCAAGCCTGCTTCATCAATGGTTGTATCTGT
GCTTGTTGATCCCAGAGAAGGAGGTGATGGAGATATAGATGGGATGATTGGGGGACCAAAATCACTGTCTCGAGTTTTTG
TAGTCGTGCTTCTGGACAGTGCAAAGTATGTAACATACTCCTGTGTCCTACCTCGATCAGGAGCTCCTCATCTTGTGACC
ACTTGA