Details for Arabidopsis Locus AT2G40900

Position : Chr2 ( 5`- 17063122 .. 17065684 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40900

Protein [Map View]
MGLRMSESAKPYFAMVCLQFGYAGMNLVTKTVLDRGMSHYVLVAYRNAFATAAIAPFALLSERKVRSKMTFPIFMRIFLL
ALLGPVIDQNLYYIGLKLTSPTFSSAVSNIVPAITIILATLFRMEKVEMRKVRCLVKVMGTLVTVVGSILMIFYKGPFIN
FFRSHLTAASSPPTADYLKAAVFLLLASLSWASFFVLQAATLKKYSAHLSMSTMVCFMGTLQSLALAFVMEHNPSALNIG
FDMNLLASAYAGIMSSSIAYYVQGLMMQRKGPVFVTAFNPLIVVIVSIMSFFVLGQGIYLGGVIGVVVLMVGVYAVLWGK
HVDDDGEETRHEDNVVAVKCCSGNNGLTIMPKIDEADEEDVETGKATSEKESSVPEVVVVVFCSENVHSVSRPN*

DNA
ATGGGATTAAGGATGTCAGAATCAGCTAAACCTTATTTTGCAATGGTCTGTCTTCAGTTCGGATACGCAGGTATGAACTT
AGTAACTAAAACCGTCCTAGACCGCGGTATGAGCCATTACGTTCTTGTTGCATACCGCAACGCTTTTGCCACAGCCGCTA
TCGCACCCTTCGCTCTTCTCTCCGAAAGGAAAGTGAGATCAAAGATGACGTTTCCAATATTCATGCGAATATTTCTTCTT
GCTCTTCTCGGGCCGGTGATTGATCAGAACTTATACTATATCGGTCTAAAACTCACATCACCAACGTTTTCCTCCGCCGT
TAGCAACATCGTGCCTGCAATTACCATTATCCTTGCCACACTTTTCAGGATGGAGAAAGTGGAGATGAGAAAAGTAAGAT
GCCTGGTAAAAGTGATGGGGACGTTAGTGACAGTGGTTGGATCCATATTGATGATATTCTACAAAGGTCCTTTCATTAAT
TTCTTCCGGTCTCACCTCACGGCCGCCTCTTCGCCGCCGACGGCTGACTATCTTAAGGCTGCCGTCTTCCTACTCCTCGC
TTCCCTCTCATGGGCGTCGTTCTTTGTTCTTCAGGCTGCGACTTTGAAGAAATACTCAGCCCATCTCTCAATGTCAACAA
TGGTGTGTTTCATGGGAACGTTACAGTCTTTAGCCCTAGCCTTCGTAATGGAACACAATCCTTCTGCTTTGAACATCGGT
TTTGACATGAACCTTCTCGCTTCTGCCTACGCGGGAATAATGTCGTCGAGCATAGCTTACTACGTTCAAGGACTTATGAT
GCAGCGAAAAGGACCGGTCTTTGTCACTGCTTTTAACCCTCTTATCGTTGTCATTGTCTCCATCATGAGCTTCTTCGTTC
TCGGTCAAGGAATCTACCTTGGAGGGGTTATTGGAGTGGTTGTTTTGATGGTGGGAGTCTACGCCGTGTTATGGGGCAAA
CATGTAGATGATGACGGCGAAGAAACACGCCATGAAGATAACGTTGTAGCCGTTAAGTGTTGTAGTGGCAATAATGGTCT
AACGATAATGCCGAAAATCGACGAAGCTGATGAGGAGGATGTTGAAACCGGAAAGGCTACGTCGGAGAAGGAGTCGTCAG
TTCCGGAAGTGGTGGTGGTAGTTTTTTGTAGTGAAAATGTGCATAGCGTTTCACGACCTAACTAG