Details for Arabidopsis Locus AT2G40850

Position : Chr2 ( 5`- 17051123 .. 17053292 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40850

Protein [Map View]
MNCLATTIIITCKPTLISDMAVAIDPFSDKFPYFNRSSQRCRLQSLTNLDFNFLAQSFNHTFEDDNIHRSVSSPCFSIAA
SANMEEDLKATTAPRIEILGGQRVPTVRALVAEVTMAMVSGAQPLLLPSGMGGAYLLQTGKGHNIAVAKPVDEEPLAFNN
PKKSGNLMLGQPGMKHSIPVGETGIRELAAYLLDYQGFSGVPPTALVSISHVPFHVSDAFSFSSMPYKVASLQRFVGHDF
DAGELGPGSFTATSVHRIGILDVRLLNLDRHAGNMLVKRCDKKEAYNRLGTAELVPIDHGLCLPECLDDPYFEWLNWPQA
LVPFSDTELDYISNLDPFKDAELLRTELHSLPESAIRVLVVCTVFLKQAAAAGLCLAEIGEKMTRDFSKGEESFSLLETL
CTKAKASVFGKTSEDSDYSHEGNEVNTELQCGMFKFDGGDTPCEAEISEVFHVSKPPLVPRGPRANTIPNDVTASMSSSQ
NQRITHQEKSAKEKKRGGKQERCTVRSKSPPISPNHDESKGVSFVDMTTVEWDTFLQSFQTLLQDALSKGSTPRLGCSCE
I*

DNA
ATGAATTGCTTGGCTACGACCATAATCATCACCTGCAAGCCCACATTGATCTCGGATATGGCCGTGGCTATTGATCCTTT
CAGTGACAAGTTCCCTTACTTTAACCGATCCTCTCAAAGATGCAGACTTCAATCCCTTACCAACCTTGACTTCAACTTCC
TCGCGCAATCCTTTAATCATACGTTTGAAGATGACAACATCCATCGTAGTGTTTCCTCTCCTTGCTTTTCCATAGCTGCG
TCTGCTAATATGGAGGAAGATCTCAAAGCAACCACGGCTCCACGGATTGAGATTCTTGGTGGACAGAGAGTGCCCACCGT
TCGTGCTCTTGTGGCTGAGGTGACCATGGCTATGGTTTCTGGAGCTCAGCCTTTGCTTTTACCAAGTGGCATGGGAGGTG
CTTATCTCTTGCAAACCGGAAAGGGACATAACATTGCTGTGGCTAAACCGGTTGATGAAGAGCCTCTAGCTTTCAATAAT
CCTAAAAAGTCTGGAAATTTGATGCTCGGGCAACCGGGAATGAAACATTCAATTCCTGTTGGCGAGACGGGTATCAGAGA
ACTAGCTGCCTACCTTTTGGATTACCAAGGCTTTTCTGGTGTTCCACCAACAGCATTGGTTAGTATCTCACATGTCCCAT
TCCATGTCAGTGATGCCTTCTCTTTCTCCTCCATGCCCTATAAGGTTGCTTCCTTGCAGCGATTTGTGGGTCATGATTTT
GATGCAGGAGAATTGGGTCCAGGAAGCTTCACGGCTACTTCGGTTCATAGGATTGGAATACTTGATGTGAGACTCCTGAA
CCTTGACAGACATGCTGGAAATATGCTAGTGAAGAGATGTGACAAAAAGGAAGCTTATAATCGACTTGGGACCGCTGAGC
TTGTGCCTATTGATCATGGTCTCTGCCTCCCTGAATGCCTAGATGATCCTTACTTTGAATGGCTAAACTGGCCTCAAGCT
TTGGTTCCATTCTCTGACACTGAACTGGATTATATATCCAATCTTGACCCTTTCAAAGACGCAGAACTTCTGAGAACTGA
ACTACACTCTCTGCCGGAATCTGCCATAAGGGTCCTCGTCGTCTGCACAGTTTTCTTAAAACAAGCAGCAGCTGCAGGGC
TCTGTCTCGCGGAGATAGGCGAGAAGATGACTCGGGATTTCTCCAAGGGTGAAGAGAGTTTCAGTCTGTTAGAGACCCTC
TGCACCAAAGCGAAAGCAAGTGTCTTTGGCAAAACAAGCGAAGACAGTGACTATAGTCATGAAGGAAATGAAGTGAACAC
AGAGTTACAGTGTGGAATGTTTAAGTTTGACGGTGGAGATACACCATGTGAAGCGGAGATTTCAGAGGTATTTCATGTAT
CTAAACCACCTTTGGTTCCAAGAGGGCCACGTGCAAACACCATCCCTAACGATGTAACTGCTTCCATGTCGTCATCACAA
AACCAGCGGATTACTCATCAAGAGAAAAGTGCAAAAGAAAAGAAGAGAGGAGGCAAGCAAGAAAGATGCACCGTGAGGAG
CAAGAGCCCACCGATCAGTCCAAACCATGATGAATCAAAAGGAGTTTCCTTCGTGGACATGACAACAGTTGAATGGGATA
CGTTCCTGCAGAGCTTCCAGACACTTTTGCAAGATGCACTGAGCAAAGGGTCAACGCCAAGATTAGGATGCTCCTGCGAA
ATTTGA