Details for Arabidopsis Locus AT2G40830

Position : Chr2 ( 5`- 17042652 .. 17044859 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40830

Protein [Map View]
MSSSRNTHWCHRCQRAVRLHGQEPVCFYCGGGFVEELDMAQASPFDMFRSHRGVVERDQTFDLMDAFSVFMRNRLAERSH
DREIRGRTISSGPENFPGLAPLLIFGGQVPYRLTGDNAVEALFNGGSPGIGITRGNTGDYFFGPGLEELFEQLSAGTTRR
GPPPAPRSAIDALPTIKIAQRHLRSSDSNCPVCKDEFELGSEAKQMPCNHIYHSDCIVPWLVQHNSCPVCRQELPSASGP
SSSQNRTTPTRNYRSSSSSSSSNSRENGNERRNPFSSFWPFRSSGSSSSSTQNRGGTRNSDTSDENHNYHQQQHQQSYMG
YSGWPFDY*

DNA
ATGTCAAGCAGTCGAAATACCCACTGGTGTCACAGATGTCAGCGTGCTGTCCGCCTTCACGGCCAAGAGCCTGTATGCTT
TTATTGCGGAGGTGGATTTGTTGAAGAACTTGATATGGCTCAAGCCAGCCCCTTTGATATGTTTAGATCCCACAGGGGTG
TTGTAGAACGTGATCAGACTTTTGATCTCATGGATGCTTTCTCTGTGTTTATGAGGAACCGCTTAGCTGAAAGGAGCCAC
GACAGAGAAATCAGAGGAAGAACCATCAGTTCAGGTCCTGAAAACTTTCCTGGTCTGGCCCCTTTGTTGATCTTTGGTGG
TCAAGTCCCTTATAGACTAACTGGCGACAATGCAGTCGAAGCCCTCTTCAATGGCGGCTCCCCTGGCATTGGCATCACAC
GTGGTAACACCGGCGACTACTTCTTCGGTCCCGGCCTTGAAGAATTGTTCGAGCAGCTTTCAGCTGGCACTACTCGCCGA
GGCCCACCACCCGCACCGAGATCAGCAATAGACGCATTGCCAACTATCAAGATCGCGCAGAGGCATCTTAGGTCATCGGA
CTCGAATTGTCCCGTGTGCAAAGACGAATTCGAACTGGGATCAGAAGCGAAACAGATGCCGTGTAACCACATCTATCATT
CTGACTGCATTGTCCCGTGGCTGGTTCAGCACAACTCTTGCCCGGTCTGTCGCCAAGAGCTACCATCAGCTAGCGGACCT
TCAAGCAGTCAAAACAGAACCACCCCTACCAGAAACTACAGAAGCAGTAGTAGTAGTAGTAGTAGTAACAGTCGTGAGAA
CGGGAATGAAAGAAGGAATCCTTTCTCTTCCTTCTGGCCATTCCGTTCGTCAGGTTCAAGCTCAAGCTCCACTCAAAACC
GTGGAGGCACAAGAAACTCGGATACAAGCGATGAGAACCATAACTACCATCAACAGCAACATCAACAATCATATATGGGT
TACAGTGGCTGGCCTTTTGATTACTAA