Details for Arabidopsis Locus AT2G40820

Position : Chr2 ( 5`- 17036463 .. 17040063 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40820

Protein [Map View]
MTKVCPKTEEKRVVSEAVVEPISADVSFASNHFPTYKLGPDDQIVDEPDEDDKVPSVKDVVGKETGDLSDQHKKLSVRDL
ACKFDKNLAAASKLVDEAKLNDVTSLEGHVMLKKLRDALETMRGRMDGRNREAVEKAISMVEALAVKLTQNEGELIHDKF
EVKKLASFLKKASDDAKKLVNQEKSFACAEIESARALVMKLGGAFEEQELCSKASRDQGPNVEKLVEEVQEARRIRRLHK
PTMVIGMQHELRDLKSQIQEKSAYSVKLQREIAIIKKAEGSKSCPYVLDGAQSLGSCLRIRASSDSGIDISKCSIHWYRA
ASESSRREAISGANRSVYAPEPFDVGRVIQADIVSNGQKFTVTTDGPINTAAGLQSRVESLLRKSNSEFTVVISQMNGQD
HASRSHVFTVGKARIKLSRGWITKAREIYSTSMQLCGVRGNANVPAKALFWQLRKGLTFLLTFESEQERNAAIVLARTYA
YDCNVTLVGPDD*

DNA
ATGACTAAAGTATGTCCTAAAACAGAAGAAAAGAGAGTGGTGTCTGAAGCTGTGGTTGAACCAATTTCAGCAGATGTGAG
CTTTGCTTCTAATCATTTTCCAACGTACAAGTTAGGACCTGATGATCAGATTGTTGATGAACCTGATGAAGATGATAAAG
TTCCATCTGTCAAAGATGTCGTCGGTAAGGAGACCGGAGATTTGTCAGATCAGCACAAGAAGCTTTCTGTTCGTGATCTC
GCTTGCAAATTTGACAAGAATTTAGCTGCAGCTTCTAAGTTAGTTGATGAGGCAAAGTTAAACGATGTGACTTCTTTGGA
AGGACATGTTATGCTAAAGAAACTTAGGGATGCTTTAGAAACCATGAGAGGTCGTATGGATGGAAGAAACAGAGAAGCAG
TGGAAAAAGCTATCTCCATGGTTGAGGCACTAGCCGTTAAGTTAACTCAAAATGAAGGTGAACTAATTCATGATAAGTTT
GAAGTGAAGAAACTGGCAAGCTTCCTCAAGAAGGCTTCAGACGACGCGAAGAAGTTAGTAAACCAAGAAAAGTCGTTTGC
TTGTGCTGAAATAGAGAGTGCACGGGCTCTTGTGATGAAACTTGGAGGTGCATTTGAAGAACAGGAGCTTTGTTCTAAAG
CTTCTAGAGATCAGGGACCGAATGTGGAGAAATTGGTTGAGGAGGTTCAGGAGGCTAGACGAATTAGACGGTTGCATAAA
CCAACCATGGTGATCGGTATGCAACATGAGCTTCGTGATTTAAAGAGTCAAATCCAAGAGAAGTCTGCATATTCCGTTAA
ACTTCAAAGAGAGATAGCAATAATTAAGAAAGCTGAGGGGTCCAAGTCATGTCCGTATGTTCTGGATGGTGCACAAAGTC
TTGGCTCGTGCCTAAGAATCCGTGCCTCCTCAGACAGTGGTATAGATATTTCCAAATGCTCAATCCATTGGTACCGTGCA
GCATCTGAGTCTAGTCGAAGAGAAGCTATATCTGGTGCCAACCGGTCAGTATATGCTCCAGAACCATTTGATGTCGGGCG
AGTGATACAAGCAGACATTGTTTCAAATGGCCAGAAGTTCACCGTTACAACCGATGGTCCAATTAATACTGCTGCTGGCT
TGCAGTCACGCGTTGAATCACTCCTGCGCAAATCTAACAGTGAATTCACCGTGGTTATATCACAGATGAATGGACAAGAC
CATGCATCACGATCCCATGTATTTACTGTTGGAAAGGCGAGGATAAAGCTGTCCCGAGGATGGATCACAAAGGCTAGAGA
AATATATTCAACCTCCATGCAGCTCTGTGGAGTGAGAGGCAATGCTAACGTTCCTGCAAAGGCATTGTTCTGGCAACTTA
GAAAGGGTCTAACTTTCTTACTAACTTTCGAGTCAGAGCAAGAACGTAATGCAGCCATAGTACTCGCACGAACATATGCA
TATGATTGTAATGTCACTCTAGTTGGTCCAGATGATTGA