Details for Arabidopsis Locus AT2G40810

Position : Chr2 ( 5`- 17032464 .. 17034600 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40810

Protein [Map View]
MSSTVSNPQGILQPGSFLLPESESMKKEEAELVSVCWNQDSSCFAAGTSHGFRIYNCEPFKETFRRELKDGGFKIVEMLF
RSNILALVGGGPNSQYPSSKVLIWDDHQSRCISEFAFRSEIRAVKLRRDRIVVVLEHKIYVYNFMDLRLLHQIETQANPR
GLCCLSHHSNTSVLACPGLNRGEIRVEHFGLNMVQIINAHDSSIACMTLTLDGLLLATASTKGTLIRIFNTMDGTRLQEV
RRGVDRADIYSIALSPNVQWLAVSSDKGTVHIFSLRVRVVGEDSYSTENGALLTQQNYSNSLQGLVSPTIGTNPGSSLSF
MRGVLPKYFSSEWSYAQFHVSEVTQFFAAFGSNNTVAIIGMDGSFYRCSFDPVNGGEMGQLEYIHFMKMDNRP*

DNA
ATGAGTTCAACTGTTTCAAATCCCCAAGGAATCCTGCAACCAGGCTCATTTCTGCTTCCAGAATCAGAATCTATGAAAAA
AGAGGAAGCAGAGTTAGTTTCTGTGTGTTGGAATCAGGATTCAAGTTGTTTTGCAGCTGGAACGAGTCATGGTTTTCGTA
TATATAACTGTGAACCTTTCAAAGAAACTTTCAGGCGTGAGCTAAAGGACGGTGGTTTTAAAATCGTAGAGATGCTTTTC
CGTAGCAATATACTGGCACTTGTTGGTGGTGGACCTAACTCTCAGTATCCTTCAAGCAAAGTACTAATTTGGGATGATCA
TCAGAGCCGTTGCATTAGTGAATTTGCATTTAGGTCTGAGATTCGTGCAGTGAAATTAAGAAGGGATCGGATTGTTGTTG
TTCTTGAACATAAGATTTATGTTTATAACTTTATGGATCTTAGACTTCTTCATCAGATTGAAACTCAAGCTAATCCTAGA
GGATTGTGTTGCCTTTCTCATCATTCTAATACGTCTGTGTTGGCTTGCCCTGGTCTCAATCGAGGAGAGATTCGTGTTGA
ACATTTCGGGCTTAACATGGTACAAATCATAAATGCTCATGATTCAAGTATTGCGTGTATGACCTTGACATTGGATGGTT
TGTTGCTTGCAACTGCTAGTACAAAGGGAACTCTGATTAGAATCTTCAACACAATGGATGGAACTCGTTTGCAAGAGGTA
CGAAGAGGAGTCGACAGAGCAGATATATATAGCATTGCACTTTCACCAAATGTGCAGTGGCTGGCGGTATCAAGTGACAA
GGGGACTGTTCACATTTTCTCTCTTAGAGTTAGGGTTGTTGGGGAGGATTCTTATTCCACTGAAAATGGAGCTCTGTTGA
CACAACAAAATTATTCTAATTCTCTGCAAGGCCTTGTTTCTCCAACCATTGGTACCAATCCCGGTTCGTCATTGTCGTTT
ATGAGAGGTGTTCTACCAAAGTATTTCAGCTCGGAATGGTCATATGCACAGTTTCATGTATCAGAAGTCACACAATTCTT
CGCAGCATTTGGCAGTAACAACACGGTTGCTATTATCGGCATGGATGGAAGTTTCTACCGATGCAGCTTTGATCCCGTGA
ACGGAGGAGAGATGGGGCAACTGGAATATATCCACTTTATGAAGATGGACAACCGCCCGTGA