Details for Arabidopsis Locus AT2G40800

Position : Chr2 ( 5`- 17024391 .. 17026973 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40800

Protein [Map View]
MVKPSDFKAIQGFIRLHYTRVNPVTIGRSNPSALSSPAIPSNGVSQLQPKFSFHSLSSKPTSKNVGLYQILSSPKLNPKL
QQALGLPRVNVSFASAFRLVSTKSSGFRKVDGSFARKVVDKPVKAVSSTFARYREAIGLHIDAFWKKNSLVVFGAAGVFV
CIFLWRIMFGIASTFVGLSEGMAKYGFLALSSAIVAFSGLYLRSRFTINPDKVYRMTMRKINTAAEILEVMGAPLSGSDL
RAYVMSGGGITFKKFKPTIRSKRCFLLFPVQGSEQKGLVSVEVKKKKGQYDMKLLAVDIPMASGPDQRLFLIGDEEEYRI
GGGLISVLRDPVVKAMAATKEFDNLDRIEEEEDAERELQEAERKHREEIEKLEKEGS*

DNA
ATGGTGAAACCATCGGATTTCAAAGCAATTCAAGGGTTTATTCGGCTGCATTACACTCGGGTCAACCCTGTCACAATTGG
CCGATCAAACCCATCAGCTTTGTCTTCTCCAGCTATTCCCTCCAATGGTGTTTCTCAGCTTCAGCCTAAGTTTAGCTTCC
ACAGCTTATCCTCGAAACCCACTTCCAAAAACGTGGGATTATATCAGATTCTGTCGTCTCCTAAGCTCAATCCTAAGTTG
CAGCAAGCTTTGGGTTTGCCTCGTGTGAATGTGAGTTTTGCATCGGCGTTTAGATTGGTATCCACTAAGAGCTCTGGATT
TCGAAAGGTTGATGGGAGTTTTGCGAGAAAGGTTGTTGATAAGCCTGTCAAAGCTGTTAGTTCTACTTTTGCTAGATACC
GTGAGGCTATAGGGTTGCACATTGATGCATTTTGGAAAAAGAATAGTCTTGTTGTGTTTGGAGCTGCAGGTGTTTTTGTA
TGTATTTTCCTTTGGCGGATTATGTTTGGAATTGCTAGTACGTTTGTTGGCCTCTCAGAGGGCATGGCCAAGTATGGGTT
TCTTGCACTCTCCTCAGCCATTGTAGCATTTTCTGGATTATACCTCCGCTCAAGGTTTACAATTAATCCGGATAAAGTTT
ATAGAATGACCATGAGGAAGATCAACACGGCAGCTGAAATTCTAGAAGTTATGGGTGCTCCTCTGTCAGGATCAGATTTA
CGAGCGTATGTGATGTCAGGTGGTGGCATAACATTTAAGAAATTCAAGCCAACAATTAGGAGCAAGCGCTGCTTTCTTCT
ATTCCCCGTTCAGGGTTCTGAGCAAAAGGGCCTTGTTAGCGTTGAAGTTAAGAAGAAGAAAGGCCAGTATGACATGAAGC
TTTTGGCGGTAGATATTCCAATGGCATCTGGTCCCGACCAACGGTTATTTCTGATTGGCGATGAAGAAGAGTACAGAATT
GGTGGTGGTTTAATCTCTGTGTTAAGAGACCCTGTTGTGAAAGCAATGGCAGCAACTAAGGAGTTCGATAATCTTGATAG
AATCGAAGAGGAAGAAGACGCTGAAAGAGAACTTCAAGAAGCTGAAAGAAAGCATCGTGAAGAGATCGAGAAACTCGAGA
AGGAGGGCTCATAA