Details for Arabidopsis Locus AT2G40790

Position : Chr2 ( 5`- 17022963 .. 17024270 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40790

Protein [Map View]
MGNHCTRIPCCKKVCSCICCCNRRNKTQARSQKGSYFIKGKVHPVSRMEKWEEKITEANSHGKILVVNFKASWCLPSKTI
LPIYQELASTYTSMIFVTIDVEELAEFSHEWNVDATPTVVFLKDGRQMDKLVGGDAAELQKKTAAAANLLLRQS*

DNA
ATGGGGAATCATTGTACAAGAATTCCTTGTTGTAAAAAGGTGTGTTCATGTATCTGCTGTTGCAACAGAAGGAACAAGAC
TCAAGCTAGGAGCCAGAAAGGGTCCTACTTTATAAAAGGGAAGGTCCATCCGGTAAGTAGAATGGAGAAGTGGGAGGAGA
AGATCACAGAAGCTAATAGTCATGGCAAAATTCTTGTAGTGAATTTCAAGGCTTCGTGGTGTTTACCTAGTAAAACAATA
TTACCAATATACCAGGAGCTTGCATCCACATACACCTCAATGATATTTGTCACTATAGACGTCGAAGAGCTCGCTGAGTT
TAGTCATGAATGGAACGTGGATGCAACTCCAACAGTAGTGTTCCTTAAAGATGGGAGGCAAATGGATAAACTTGTAGGTG
GAGATGCTGCAGAGCTTCAGAAGAAAACTGCAGCAGCTGCAAATCTCCTTCTTAGACAATCTTAA