Details for Arabidopsis Locus AT2G40780

Position : Chr2 ( 5`- 17021505 .. 17022916 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40780

Protein [Map View]
MNRGRRNLKQAASDQDFTLEECQSIAQVVSLRGSNQIEIMDAKGENSLALFPAKFRESMWIRRGSFVVIDHTGKEKAQES
GSKVTSIVCKVLFFEQVRLLQKSPEWPEIFKDTRPIPAEKSSPIEQHEDDGEVDSSDDDDGMPPLQANTNRLRPFGVKCD
AETDSGSDSDS*

DNA
ATGAACAGAGGAAGAAGGAATCTGAAACAAGCGGCGTCGGACCAGGATTTCACGCTTGAGGAATGTCAGAGCATTGCCCA
AGTCGTCTCTCTCAGAGGTTCCAATCAAATTGAGATAATGGATGCAAAAGGAGAGAACTCATTAGCTTTGTTTCCAGCCA
AGTTTCGTGAGAGCATGTGGATCAGACGAGGAAGCTTTGTAGTGATTGACCATACAGGAAAGGAAAAGGCTCAAGAGTCT
GGTAGCAAAGTTACATCTATTGTATGTAAAGTTCTATTCTTTGAGCAAGTCCGTCTTCTTCAAAAGTCTCCGGAATGGCC
AGAAATCTTCAAAGATACTAGACCGATTCCAGCTGAGAAAAGCTCACCCATTGAACAGCATGAAGATGACGGTGAAGTTG
ATTCGAGTGATGATGATGATGGTATGCCTCCATTGCAAGCAAACACAAACAGATTGAGACCGTTTGGGGTGAAGTGTGAT
GCAGAAACTGATTCAGGGTCAGATTCCGATTCATAG