Details for Arabidopsis Locus AT2G40750

Position : Chr2 ( 5`- 17000454 .. 17002468 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40750

Protein [Map View]
MDSNSNNTKSIKRKVVDQLVEGYEFATQLQLLLSHQHSNQYHIDETRLVSGSGSVSGGPDPVDELMSKILGSFHKTISVL
DSFDPVAVSVPIAVEGSWNASCGDDSATPVSCNGGDSGESKKKRLGVGKGKRGCYTRKTRSHTRIVEAKSSEDRYAWRKY
GQKEILNTTFPRSYFRCTHKPTQGCKATKQVQKQDQDSEMFQITYIGYHTCTANDQTHAKTEPFDQEIIMDSEKTLAAST
AQNHVNAMVQEQENNTSSVTAIDAGMVKEEQNNNGDQSKDYYEGSSTGEDLSLVWQETMMFDDHQNHYYCGETSTTSHQF
GFIDNDDQFSSFFDSYCADYERTSAM*

DNA
ATGGATTCGAATAGTAACAACACGAAATCCATAAAGAGAAAAGTTGTCGACCAACTTGTCGAAGGCTATGAATTCGCTAC
TCAGCTTCAGCTTCTCCTTTCTCATCAACACTCTAACCAGTACCACATCGATGAGACCCGTCTTGTTTCCGGGTCGGGTT
CAGTTTCCGGTGGTCCAGATCCCGTTGATGAGCTCATGTCTAAGATCTTGGGATCTTTCCATAAAACTATATCGGTTCTT
GATTCTTTTGATCCCGTCGCCGTCTCTGTCCCCATCGCCGTCGAGGGTTCATGGAATGCTTCATGTGGGGATGATTCGGC
GACTCCGGTGAGTTGCAACGGTGGAGATTCCGGTGAGAGTAAGAAGAAGAGATTAGGGGTTGGTAAGGGTAAAAGAGGAT
GCTACACTAGAAAGACGAGATCACATACAAGGATCGTGGAAGCTAAAAGTTCTGAAGACAGATATGCTTGGAGGAAATAT
GGACAAAAGGAGATTCTTAATACCACATTCCCAAGAAGTTACTTTAGATGCACACACAAGCCAACGCAAGGATGCAAAGC
AACAAAGCAAGTTCAGAAACAGGATCAAGATTCTGAGATGTTCCAAATCACATACATTGGCTACCACACATGCACTGCCA
ATGACCAAACGCACGCGAAGACCGAGCCTTTTGATCAAGAAATCATTATGGATTCGGAAAAGACATTGGCTGCTAGCACT
GCTCAGAACCATGTCAATGCTATGGTGCAAGAGCAAGAGAACAACACCAGCAGTGTGACAGCAATAGACGCAGGCATGGT
TAAGGAGGAACAAAATAACAATGGTGATCAGAGTAAAGATTATTATGAGGGCTCTTCGACAGGTGAGGACTTGTCATTGG
TTTGGCAAGAGACGATGATGTTTGATGATCATCAAAATCACTACTATTGTGGTGAAACCAGTACTACTTCTCATCAATTT
GGTTTCATCGACAACGATGATCAGTTTTCCTCCTTCTTCGACTCATATTGTGCTGATTATGAAAGAACAAGTGCTATGTG
A