Details for Arabidopsis Locus AT2G40670

Position : Chr2 ( 5`- 16970230 .. 16971234 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40670

Protein [Map View]
MNSSGGSCSSLMDVVAYDHHLHHGHDEELHVLAVDDNLIDRKLVERLLKISCCKVTTAENALRALEYLGLGDQNQHIDAL
TCNVMKVSLIITDYCMPGMTGFELLKKVKQESSNLREVPVVIMSSENIPTRINKCLASGAQMFMQKPLKLADVEKLKCHL
MNCRS*

DNA
ATGAACAGTTCAGGAGGTTCTTGTTCGTCTTTAATGGATGTGGTGGCTTATGATCATCATCTTCATCATGGTCATGATGA
AGAGCTTCATGTTTTAGCTGTAGATGATAATCTTATTGACCGTAAACTCGTTGAGAGGTTGCTCAAGATCTCTTGTTGCA
AAGTGACAACAGCAGAGAATGCGCTTAGAGCATTGGAGTATTTGGGTTTGGGAGATCAAAATCAGCATATTGATGCATTG
ACCTGTAACGTTATGAAGGTGAGTCTAATCATCACCGATTACTGTATGCCTGGAATGACAGGTTTTGAGCTACTCAAGAA
AGTGAAGCAGGAGTCATCAAATCTGAGAGAGGTTCCTGTTGTGATAATGTCTTCAGAGAATATTCCTACTCGCATAAACA
AATGTTTAGCGAGTGGAGCTCAAATGTTTATGCAGAAGCCTTTGAAGCTTGCTGATGTTGAGAAGCTTAAATGTCATCTC
ATGAACTGCAGAAGCTAA