Details for Arabidopsis Locus AT2G40630

Position : Chr2 ( 5`- 16958146 .. 16961144 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40630

Protein [Map View]
MEEQRGISSGVVSEPASNSVISGEKRNGNGLDEKDELGSKRVKVPDLASDAKTSSLQSHGNSNSVQQPNLSSEKLSKVSK
VLVAPDAEGIRRVVRENDVLSKDIKPSSTVETRTYLPKAKSISTDDNRRVVNSGKQALLENHTVKTDDSKCRVVKNISLL
KPRETTESVVSQRGAAEPSVSVPVGDKVSPFQMCSSADGSLGESDSMRRWREMKRNGFLSGPLGGVAAPTSTVVTTPVEV
PAPKQQKNKRRGGESLKKKNDVPKKEQQLVDRFANVTAPSGLLTELNPGIINHVRTKKQVCSIIEALIRSSNDDATTRER
HGDFNVRDAIREDRALAFKLPSTGVSDNAISITNPEQATSLAVEAATVASQWLEFLQQDLSGRLSAVQDSRNRVQNILTT
ELPLLASSRESSSNQANSLEMVTTNTSGDASSDKAATETHQKRWTAKFDQINKALYDEQRDLERSLNQVKEMQSRCNHGL
RQMEEYSPFSSQSSDSSFGKDGNQETSMAVQAAAASIFSTCSFLLSMMKPPPTGS*

DNA
ATGGAGGAACAGAGAGGAATTTCCTCTGGTGTTGTGTCGGAACCTGCATCGAATTCTGTGATTTCTGGCGAGAAGCGTAA
CGGAAATGGATTAGATGAGAAAGATGAATTAGGGTCTAAACGTGTGAAAGTCCCAGATCTGGCTTCTGATGCGAAAACCA
GTAGTTTGCAATCTCATGGAAACAGTAATAGTGTTCAGCAACCAAATCTTAGTAGTGAGAAGTTGTCGAAAGTATCTAAA
GTGCTTGTGGCTCCTGATGCTGAAGGTATAAGAAGAGTAGTTAGAGAAAATGATGTTTTGTCTAAAGATATAAAACCTTC
CTCAACTGTTGAGACGAGAACATACTTGCCTAAGGCCAAGTCAATTTCTACAGATGATAATAGACGCGTTGTTAATTCTG
GAAAACAGGCTTTGCTTGAGAATCATACTGTAAAAACAGATGATAGTAAGTGTCGTGTTGTTAAGAATATTAGCCTCTTG
AAACCGAGGGAGACTACTGAATCTGTTGTAAGTCAACGTGGAGCAGCAGAGCCTTCGGTTTCAGTTCCTGTTGGCGATAA
AGTAAGTCCTTTTCAGATGTGTAGTAGTGCAGATGGCTCATTAGGTGAGTCAGATTCGATGCGGCGATGGAGGGAAATGA
AGCGGAATGGTTTTCTATCAGGCCCTTTGGGTGGAGTTGCAGCACCAACTTCTACAGTAGTGACTACGCCTGTTGAAGTA
CCTGCGCCAAAGCAACAGAAGAATAAGCGGAGAGGTGGTGAGTCTCTCAAGAAGAAAAACGATGTCCCTAAGAAGGAACA
ACAGCTGGTAGATAGGTTCGCCAATGTTACTGCTCCAAGTGGATTGCTGACGGAATTGAACCCGGGAATCATTAACCATG
TCAGGACTAAGAAACAGGTCTGCTCAATTATTGAAGCTTTGATTCGAAGTAGTAATGATGATGCTACCACGAGGGAAAGA
CATGGCGATTTCAATGTAAGAGACGCAATCAGAGAAGATAGAGCATTAGCCTTTAAGTTACCATCCACCGGGGTGTCTGA
TAATGCCATTTCCATTACAAATCCTGAACAAGCCACATCTCTTGCTGTTGAAGCTGCTACCGTAGCTTCCCAATGGTTGG
AGTTTCTTCAACAAGACCTCAGCGGACGACTTTCAGCTGTGCAGGATAGTAGGAATAGAGTTCAAAATATTTTGACTACT
GAGTTACCGCTTCTCGCTTCATCAAGGGAATCTTCTTCTAACCAAGCAAATTCTCTTGAGATGGTGACTACGAATACCTC
TGGTGATGCTTCGTCCGATAAAGCAGCAACCGAGACACATCAGAAGAGGTGGACTGCAAAATTTGATCAGATAAATAAAG
CTCTGTATGATGAACAGAGAGATTTGGAACGTTCGCTAAACCAAGTGAAGGAAATGCAGTCACGATGTAACCATGGTCTA
CGACAAATGGAAGAGTACTCGCCTTTTAGTTCCCAATCATCCGATTCAAGTTTTGGGAAAGACGGTAATCAGGAGACTAG
TATGGCGGTTCAGGCGGCTGCAGCTTCTATTTTTTCAACCTGCAGTTTTCTTCTGTCAATGATGAAGCCGCCGCCTACCG
GTTCTTAA