Details for Arabidopsis Locus AT2G40620

Position : Chr2 ( 5`- 16954541 .. 16956978 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT2G40620

Protein [Map View]
MEDPSNPQPNQSNLSQCPPLATAPTPAPVRGPYHRRAHSEVQFRLPEDLDLSEPFGGFDELGSEDDLFCSYMDIEKLGSG
SGSASDSAGPSAPRSDNPFSAENGGAEAGNSRPRHRHSLSVDGSSTLESIEAKKAMAPDKLAELWVVDPKRAKRIIANRQ
SAARSKERKARYILELERKVQTLQTEATTLSAQLSLFQRDTTGLSSENTELKLRLQVMEQQAKLRDALNEQLKKEVERLK
FATGEVSPADAYNLGMAHMQYQQQPQQSFFQHHHQQQTDAQNLQQMTHQFHLFQPNNNQNQSSRTNPPTAHQLMHHATSN
APAQSHSYSEAMHEDHLGRLQGLDISSCGRGSNFGRSDTVSESSSTM*

DNA
ATGGAGGATCCTTCTAACCCACAACCAAACCAGAGCAATCTCTCGCAATGCCCGCCTTTAGCCACAGCTCCGACACCTGC
GCCAGTTCGTGGTCCGTACCACCGGAGAGCACATTCGGAGGTCCAATTCCGTCTCCCTGAAGATCTGGATCTCTCTGAAC
CATTCGGAGGATTCGATGAGCTTGGATCCGAAGATGATCTCTTTTGCTCATACATGGACATTGAGAAACTTGGATCCGGA
TCCGGATCCGCATCCGATTCGGCTGGTCCTTCTGCTCCTAGGTCTGATAACCCGTTTTCCGCTGAGAATGGAGGTGCGGA
GGCTGGGAATTCGAGACCTCGACACAGGCATAGCCTCTCCGTTGATGGCTCTTCGACTTTGGAGTCAATTGAGGCTAAGA
AAGCTATGGCTCCTGATAAGCTCGCTGAGCTTTGGGTCGTCGACCCTAAAAGAGCTAAAAGGATAATTGCTAATCGACAG
TCTGCTGCTCGTTCGAAAGAGAGGAAGGCTCGGTATATCTTGGAGCTCGAGAGGAAAGTTCAGACCTTGCAAACTGAAGC
TACTACCCTTTCAGCACAGTTGTCTTTGTTCCAGAGAGACACAACTGGTTTGTCATCTGAGAATACAGAGCTCAAGCTTC
GTTTACAGGTCATGGAACAACAAGCTAAGTTGCGAGATGCACTGAACGAGCAACTGAAAAAGGAAGTTGAGAGGCTGAAA
TTCGCCACGGGAGAAGTCTCACCCGCGGATGCTTATAACCTCGGAATGGCACACATGCAATATCAGCAACAACCACAACA
ATCCTTCTTTCAACATCATCATCAGCAACAAACCGATGCTCAAAACCTGCAACAAATGACTCATCAGTTTCATCTCTTCC
AGCCTAACAACAACCAGAACCAATCTTCTCGCACAAACCCTCCCACCGCTCATCAGCTTATGCATCACGCTACTTCTAAT
GCCCCGGCTCAATCTCATTCCTATTCAGAGGCAATGCATGAAGACCATCTTGGCCGGTTACAGGGGCTTGACATTAGCAG
CTGTGGCAGAGGCTCAAACTTTGGTAGGTCTGACACCGTCAGTGAAAGCAGCAGCACTATGTGA